Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8RN98

Protein Details
Accession A0A0J8RN98    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
20-39LRRGNQTSRRGKERRRSNYTHydrophilic
71-90EPQLIRRRLRPGRRRCDSTPBasic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 4, plas 3, E.R. 2, golg 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGTSGLVGPSLIFFASCFVLRRGNQTSRRGKERRRSNYTLQVLNEEGNRWHQSIAQPWEGATQPVWRHPVEPQLIRRRLRPGRRRCDSTPDPIDAELGRRRPIQRNFRGTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.1
4 0.11
5 0.12
6 0.19
7 0.2
8 0.27
9 0.32
10 0.39
11 0.46
12 0.54
13 0.62
14 0.62
15 0.72
16 0.73
17 0.75
18 0.76
19 0.79
20 0.8
21 0.79
22 0.79
23 0.76
24 0.78
25 0.74
26 0.69
27 0.58
28 0.5
29 0.42
30 0.36
31 0.3
32 0.2
33 0.16
34 0.15
35 0.16
36 0.14
37 0.14
38 0.14
39 0.16
40 0.21
41 0.25
42 0.22
43 0.2
44 0.2
45 0.21
46 0.19
47 0.18
48 0.12
49 0.12
50 0.12
51 0.15
52 0.18
53 0.17
54 0.18
55 0.19
56 0.25
57 0.26
58 0.31
59 0.36
60 0.43
61 0.51
62 0.51
63 0.53
64 0.56
65 0.6
66 0.66
67 0.68
68 0.68
69 0.72
70 0.79
71 0.83
72 0.77
73 0.78
74 0.72
75 0.71
76 0.66
77 0.58
78 0.51
79 0.44
80 0.42
81 0.32
82 0.33
83 0.29
84 0.28
85 0.28
86 0.32
87 0.37
88 0.45
89 0.55
90 0.6
91 0.64