Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RZK3

Protein Details
Accession A0A0J8RZK3    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
154-175MEAKKAKLERKKKLAALSKSKRBasic
NLS Segment(s)
PositionSequence
5-25KRERLLKEAKHRELEVGRGKK
156-175AKKAKLERKKKLAALSKSKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Pfam View protein in Pfam  
PF08243  SPT2  
Amino Acid Sequences MSKAKRERLLKEAKHRELEVGRGKKSITPGASPSVPNRMKSLSRKTSAEPEYKGTARPSSATSYAGTAGLPSRRGASAGAQKGSQGKHARRRVVDEYLGTDEEDEGDYYGADDYDDYSDASSDMEAGIMDMEDEEQEALRQAKAEDERELRAEMEAKKAKLERKKKLAALSKSKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.7
3 0.67
4 0.59
5 0.59
6 0.58
7 0.54
8 0.48
9 0.44
10 0.44
11 0.4
12 0.42
13 0.4
14 0.33
15 0.3
16 0.31
17 0.34
18 0.36
19 0.35
20 0.33
21 0.36
22 0.36
23 0.34
24 0.33
25 0.33
26 0.37
27 0.43
28 0.51
29 0.49
30 0.51
31 0.53
32 0.53
33 0.58
34 0.57
35 0.54
36 0.46
37 0.42
38 0.42
39 0.4
40 0.4
41 0.33
42 0.29
43 0.24
44 0.23
45 0.22
46 0.21
47 0.21
48 0.2
49 0.18
50 0.17
51 0.16
52 0.15
53 0.12
54 0.09
55 0.1
56 0.1
57 0.1
58 0.09
59 0.1
60 0.1
61 0.11
62 0.11
63 0.13
64 0.19
65 0.22
66 0.22
67 0.21
68 0.21
69 0.24
70 0.24
71 0.26
72 0.25
73 0.29
74 0.38
75 0.44
76 0.48
77 0.46
78 0.52
79 0.49
80 0.46
81 0.42
82 0.33
83 0.29
84 0.27
85 0.26
86 0.19
87 0.15
88 0.11
89 0.1
90 0.09
91 0.07
92 0.05
93 0.05
94 0.04
95 0.05
96 0.05
97 0.04
98 0.04
99 0.04
100 0.04
101 0.05
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.04
122 0.04
123 0.04
124 0.06
125 0.08
126 0.08
127 0.09
128 0.09
129 0.15
130 0.19
131 0.22
132 0.26
133 0.27
134 0.3
135 0.31
136 0.32
137 0.26
138 0.24
139 0.26
140 0.22
141 0.29
142 0.33
143 0.31
144 0.36
145 0.4
146 0.47
147 0.52
148 0.61
149 0.62
150 0.66
151 0.74
152 0.74
153 0.79
154 0.81
155 0.81