Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RUD9

Protein Details
Accession A0A0J8RUD9   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-21QSPKISRVTKPHQSNKQSSLHydrophilic
NLS Segment(s)
PositionSequence
98-99PK
Subcellular Location(s) nucl 18, mito_nucl 13.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MQSPKISRVTKPHQSNKQSSLQQSQCCLKKTLVKKLWEYNIKCGSDVYLVIVDHMGDDVVQFFTTKFMVDQQLTEGFPLSEKSLTLSSRKANNIRKLPKARKVLKTYRTWLSQPTLPTNPCRVPETLCSELPVSATSRAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.78
4 0.78
5 0.74
6 0.68
7 0.68
8 0.64
9 0.59
10 0.57
11 0.59
12 0.55
13 0.51
14 0.49
15 0.42
16 0.44
17 0.49
18 0.54
19 0.54
20 0.54
21 0.57
22 0.62
23 0.68
24 0.68
25 0.63
26 0.61
27 0.61
28 0.56
29 0.5
30 0.42
31 0.35
32 0.27
33 0.24
34 0.17
35 0.11
36 0.1
37 0.1
38 0.1
39 0.08
40 0.07
41 0.07
42 0.05
43 0.03
44 0.03
45 0.03
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.06
52 0.06
53 0.05
54 0.07
55 0.1
56 0.1
57 0.1
58 0.1
59 0.12
60 0.12
61 0.12
62 0.1
63 0.07
64 0.07
65 0.08
66 0.07
67 0.06
68 0.06
69 0.08
70 0.1
71 0.12
72 0.13
73 0.16
74 0.19
75 0.24
76 0.29
77 0.36
78 0.42
79 0.5
80 0.58
81 0.61
82 0.66
83 0.72
84 0.75
85 0.75
86 0.77
87 0.77
88 0.76
89 0.79
90 0.79
91 0.77
92 0.77
93 0.73
94 0.69
95 0.65
96 0.58
97 0.53
98 0.48
99 0.44
100 0.4
101 0.41
102 0.41
103 0.39
104 0.42
105 0.45
106 0.44
107 0.43
108 0.42
109 0.37
110 0.35
111 0.39
112 0.43
113 0.4
114 0.37
115 0.36
116 0.34
117 0.32
118 0.29
119 0.24
120 0.19
121 0.16