Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RQ92

Protein Details
Accession A0A0J8RQ92   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
146-166PGPLPRRKERHVLKNWHPNLDBasic
NLS Segment(s)
PositionSequence
84-114SKRPKREAPYLLTAKMEAGRKKARAQKNKGK
Subcellular Location(s) mito 17, nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001357  BRCT_dom  
IPR036420  BRCT_dom_sf  
Pfam View protein in Pfam  
PF00533  BRCT  
PROSITE View protein in PROSITE  
PS50172  BRCT  
CDD cd17731  BRCT_TopBP1_rpt2_like  
Amino Acid Sequences MGKSFHKVTVCIAGTFGAQNDKIKQWVEVNGGTFSKKVTADVTHLIATEPAVRKNVPEVRAAKRIKGIKIVSYEWLEDSLLSKSKRPKREAPYLLTAKMEAGRKKARAQKNKGKDGNTTRQLSELDGYHPYTDNTGHRYSAILVRPGPLPRRKERHVLKNWHPNLDLANFLVRSESSINRPKPFHCEEDNLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.2
4 0.15
5 0.15
6 0.18
7 0.21
8 0.22
9 0.24
10 0.24
11 0.26
12 0.25
13 0.28
14 0.29
15 0.29
16 0.29
17 0.28
18 0.28
19 0.26
20 0.23
21 0.19
22 0.18
23 0.16
24 0.15
25 0.15
26 0.16
27 0.19
28 0.22
29 0.23
30 0.2
31 0.2
32 0.19
33 0.16
34 0.14
35 0.17
36 0.16
37 0.15
38 0.17
39 0.17
40 0.17
41 0.24
42 0.3
43 0.26
44 0.3
45 0.34
46 0.37
47 0.46
48 0.47
49 0.42
50 0.42
51 0.46
52 0.41
53 0.43
54 0.39
55 0.34
56 0.37
57 0.36
58 0.32
59 0.29
60 0.27
61 0.2
62 0.19
63 0.15
64 0.11
65 0.11
66 0.09
67 0.13
68 0.13
69 0.16
70 0.25
71 0.32
72 0.41
73 0.45
74 0.53
75 0.55
76 0.66
77 0.68
78 0.63
79 0.64
80 0.58
81 0.53
82 0.44
83 0.37
84 0.27
85 0.25
86 0.24
87 0.17
88 0.2
89 0.23
90 0.25
91 0.32
92 0.4
93 0.46
94 0.53
95 0.61
96 0.66
97 0.71
98 0.79
99 0.78
100 0.71
101 0.7
102 0.68
103 0.68
104 0.64
105 0.57
106 0.47
107 0.44
108 0.42
109 0.35
110 0.28
111 0.2
112 0.15
113 0.14
114 0.15
115 0.14
116 0.14
117 0.13
118 0.12
119 0.14
120 0.15
121 0.17
122 0.18
123 0.17
124 0.17
125 0.18
126 0.18
127 0.22
128 0.22
129 0.21
130 0.2
131 0.21
132 0.24
133 0.28
134 0.34
135 0.35
136 0.39
137 0.46
138 0.54
139 0.56
140 0.64
141 0.69
142 0.72
143 0.75
144 0.78
145 0.78
146 0.81
147 0.81
148 0.76
149 0.67
150 0.57
151 0.51
152 0.43
153 0.34
154 0.24
155 0.25
156 0.19
157 0.18
158 0.18
159 0.14
160 0.15
161 0.18
162 0.2
163 0.23
164 0.33
165 0.39
166 0.44
167 0.47
168 0.47
169 0.52
170 0.55
171 0.54
172 0.5