Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8S692

Protein Details
Accession A0A0J8S692   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
94-118LTGWRKTKSDVRRRIIKYRQGKKGSHydrophilic
NLS Segment(s)
PositionSequence
105-112RRRIIKYR
Subcellular Location(s) mito 17.5, cyto_mito 12, cyto 5.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MTPSFSVMHSNAASAFSYLASNKLHETGKALPLETLRRFLAVFVKSKGNAYFSSEANPLGSKSKNEAPHLSARCFRRSGISSLRLHLSDRDFILTGWRKTKSDVRRRIIKYRQGKKGSLAELAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.09
4 0.1
5 0.1
6 0.12
7 0.12
8 0.13
9 0.14
10 0.17
11 0.17
12 0.16
13 0.2
14 0.21
15 0.25
16 0.25
17 0.24
18 0.22
19 0.23
20 0.3
21 0.27
22 0.26
23 0.21
24 0.2
25 0.2
26 0.2
27 0.23
28 0.2
29 0.21
30 0.2
31 0.23
32 0.23
33 0.25
34 0.25
35 0.21
36 0.18
37 0.21
38 0.21
39 0.18
40 0.21
41 0.19
42 0.18
43 0.16
44 0.16
45 0.12
46 0.12
47 0.13
48 0.1
49 0.13
50 0.19
51 0.22
52 0.25
53 0.26
54 0.27
55 0.34
56 0.37
57 0.36
58 0.36
59 0.35
60 0.36
61 0.34
62 0.31
63 0.29
64 0.29
65 0.32
66 0.34
67 0.38
68 0.36
69 0.37
70 0.39
71 0.34
72 0.32
73 0.3
74 0.25
75 0.2
76 0.2
77 0.2
78 0.18
79 0.17
80 0.25
81 0.28
82 0.29
83 0.32
84 0.34
85 0.33
86 0.37
87 0.46
88 0.48
89 0.52
90 0.59
91 0.62
92 0.69
93 0.75
94 0.81
95 0.82
96 0.81
97 0.81
98 0.81
99 0.84
100 0.8
101 0.76
102 0.73
103 0.72
104 0.65