Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8U9E6

Protein Details
Accession A0A0J8U9E6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
49-73FDVYVRRHRHRLREKREEREEQRNGBasic
NLS Segment(s)
PositionSequence
56-64HRHRLREKR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MNENLLDIRNIEDPSFSAFVAVEVLSSMVNSNLKTLVSNVKLLVGELDFDVYVRRHRHRLREKREEREEQRNGEEEDRHNKVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.15
4 0.12
5 0.11
6 0.11
7 0.12
8 0.11
9 0.06
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.07
17 0.07
18 0.07
19 0.08
20 0.08
21 0.08
22 0.09
23 0.14
24 0.14
25 0.14
26 0.14
27 0.14
28 0.14
29 0.14
30 0.13
31 0.07
32 0.06
33 0.05
34 0.06
35 0.04
36 0.04
37 0.06
38 0.06
39 0.12
40 0.16
41 0.2
42 0.29
43 0.35
44 0.46
45 0.56
46 0.66
47 0.71
48 0.78
49 0.83
50 0.84
51 0.88
52 0.87
53 0.83
54 0.83
55 0.79
56 0.72
57 0.68
58 0.62
59 0.56
60 0.5
61 0.48
62 0.43
63 0.45