Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8UIV3

Protein Details
Accession A0A0J8UIV3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
24-46QQEPPPQPQQWRRRNRRWLSAIPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, mito 2, pero 1, golg 1, vacu 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHHWNRFVADKDFEQHDIQTDTPQQEPPPQPQQWRRRNRRWLSAIPISAWVRSYFIFTGVIIFLVAMFVTANNTYPVKGGFLDSKPSLIAHTMAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.27
4 0.25
5 0.23
6 0.22
7 0.23
8 0.22
9 0.22
10 0.24
11 0.22
12 0.27
13 0.3
14 0.33
15 0.38
16 0.39
17 0.46
18 0.54
19 0.64
20 0.66
21 0.74
22 0.77
23 0.79
24 0.86
25 0.84
26 0.84
27 0.8
28 0.75
29 0.71
30 0.67
31 0.57
32 0.46
33 0.45
34 0.35
35 0.28
36 0.24
37 0.17
38 0.13
39 0.12
40 0.14
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.08
47 0.08
48 0.06
49 0.05
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.04
57 0.05
58 0.06
59 0.08
60 0.09
61 0.09
62 0.1
63 0.11
64 0.11
65 0.11
66 0.13
67 0.16
68 0.18
69 0.24
70 0.24
71 0.24
72 0.23
73 0.23
74 0.22
75 0.18