Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RNW0

Protein Details
Accession A0A0J8RNW0    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-98GLDFDKRRLRRMYKRRSRRTTSILGEHydrophilic
NLS Segment(s)
PositionSequence
78-90KRRLRRMYKRRSR
Subcellular Location(s) cyto_mito 8.333, cyto 8, mito 7.5, cyto_nucl 7.333, nucl 5.5, extr 4
Family & Domain DBs
Amino Acid Sequences MTSLDPPCVFFNVVVTVESAPRTLVSTPAVVGSLERFPLPANSGGNKRTTWTPTNGGYDGRLRLQTNSTPAHGLDFDKRRLRRMYKRRSRRTTSILGEYRRSYQTTSTPVEFHSGARPRFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.14
5 0.15
6 0.13
7 0.1
8 0.09
9 0.11
10 0.1
11 0.11
12 0.11
13 0.12
14 0.12
15 0.12
16 0.12
17 0.1
18 0.1
19 0.1
20 0.09
21 0.09
22 0.09
23 0.08
24 0.08
25 0.1
26 0.12
27 0.13
28 0.14
29 0.16
30 0.2
31 0.21
32 0.23
33 0.22
34 0.21
35 0.22
36 0.25
37 0.24
38 0.25
39 0.27
40 0.28
41 0.31
42 0.3
43 0.27
44 0.23
45 0.22
46 0.19
47 0.17
48 0.16
49 0.13
50 0.14
51 0.16
52 0.16
53 0.18
54 0.19
55 0.18
56 0.17
57 0.16
58 0.17
59 0.15
60 0.15
61 0.18
62 0.21
63 0.26
64 0.33
65 0.34
66 0.38
67 0.45
68 0.53
69 0.56
70 0.63
71 0.69
72 0.72
73 0.82
74 0.88
75 0.9
76 0.89
77 0.87
78 0.83
79 0.81
80 0.75
81 0.74
82 0.7
83 0.64
84 0.6
85 0.54
86 0.51
87 0.45
88 0.41
89 0.33
90 0.3
91 0.32
92 0.34
93 0.37
94 0.35
95 0.33
96 0.33
97 0.36
98 0.32
99 0.27
100 0.3
101 0.33