Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3JF68

Protein Details
Accession G3JF68   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
392-421KAYPPPLPEKKVKKVKDKGSRFPGRPKLTABasic
NLS Segment(s)
PositionSequence
399-418PEKKVKKVKDKGSRFPGRPK
Subcellular Location(s) cyto 20, cyto_nucl 13.166, cyto_mito 12.166, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002305  aa-tRNA-synth_Ic  
IPR014729  Rossmann-like_a/b/a_fold  
IPR002307  Tyr-tRNA-ligase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004831  F:tyrosine-tRNA ligase activity  
GO:0006437  P:tyrosyl-tRNA aminoacylation  
KEGG cmt:CCM_04882  -  
Pfam View protein in Pfam  
PF00579  tRNA-synt_1b  
CDD cd00805  TyrRS_core  
Amino Acid Sequences MRVLAVGAPATFDPSEKLPLQEFLTHENKLHCSDETPDNCSRLFAIMATNGTQTKDERLALIRENLAEVLNQEILEKILDEGRNPKIYWGTATTAPPHCGYFVPAIKIAQLLAAGCEMTILLADIHAFLDNLKAPIEMVAQRAEYYRFMITAILEAVGIPTDKLKFVLGSSYQKTPDYVMDVYRMASVVSEHDARRAGSETVKQSANPPLSGLLYPVLQILDEQYLDVDAQFGGMDQRKLFIAAKDWLPKLGYRERAHLMNPLVPGLQGAKMSSSDPNSKIDLLDTEDAIRKKISKAECAPKVVEGNGVLAFTEYVLLPAAALRGKKEFVVSRRDDTPLVYTSIEEMHEDYKNDKLTPQFLKPAVAQALVDLTAPIRAAFESSQEWKDITLKAYPPPLPEKKVKKVKDKGSRFPGRPKLTADAAEGAVAEADAAPAAAEPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.21
3 0.21
4 0.24
5 0.22
6 0.26
7 0.28
8 0.3
9 0.3
10 0.31
11 0.35
12 0.33
13 0.34
14 0.35
15 0.35
16 0.34
17 0.35
18 0.28
19 0.26
20 0.3
21 0.37
22 0.36
23 0.39
24 0.39
25 0.38
26 0.38
27 0.36
28 0.31
29 0.23
30 0.21
31 0.15
32 0.14
33 0.15
34 0.17
35 0.17
36 0.19
37 0.18
38 0.18
39 0.2
40 0.18
41 0.2
42 0.22
43 0.22
44 0.22
45 0.24
46 0.27
47 0.29
48 0.32
49 0.28
50 0.25
51 0.25
52 0.23
53 0.2
54 0.16
55 0.13
56 0.12
57 0.11
58 0.1
59 0.1
60 0.09
61 0.09
62 0.09
63 0.09
64 0.07
65 0.11
66 0.12
67 0.13
68 0.19
69 0.24
70 0.28
71 0.27
72 0.29
73 0.27
74 0.27
75 0.29
76 0.27
77 0.25
78 0.25
79 0.27
80 0.3
81 0.3
82 0.32
83 0.29
84 0.26
85 0.24
86 0.2
87 0.21
88 0.22
89 0.22
90 0.23
91 0.23
92 0.23
93 0.22
94 0.22
95 0.19
96 0.13
97 0.1
98 0.07
99 0.06
100 0.06
101 0.06
102 0.05
103 0.05
104 0.04
105 0.04
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.04
112 0.04
113 0.05
114 0.05
115 0.04
116 0.06
117 0.08
118 0.08
119 0.08
120 0.08
121 0.08
122 0.09
123 0.11
124 0.11
125 0.11
126 0.12
127 0.12
128 0.12
129 0.14
130 0.14
131 0.12
132 0.13
133 0.12
134 0.11
135 0.11
136 0.11
137 0.1
138 0.09
139 0.08
140 0.06
141 0.06
142 0.06
143 0.05
144 0.05
145 0.05
146 0.04
147 0.05
148 0.06
149 0.06
150 0.07
151 0.07
152 0.07
153 0.07
154 0.11
155 0.13
156 0.19
157 0.21
158 0.23
159 0.24
160 0.24
161 0.25
162 0.22
163 0.19
164 0.18
165 0.16
166 0.14
167 0.14
168 0.14
169 0.14
170 0.13
171 0.12
172 0.08
173 0.07
174 0.07
175 0.06
176 0.08
177 0.1
178 0.1
179 0.12
180 0.13
181 0.13
182 0.14
183 0.15
184 0.14
185 0.13
186 0.18
187 0.18
188 0.2
189 0.21
190 0.2
191 0.2
192 0.25
193 0.24
194 0.19
195 0.18
196 0.15
197 0.16
198 0.16
199 0.14
200 0.08
201 0.07
202 0.07
203 0.07
204 0.06
205 0.05
206 0.05
207 0.05
208 0.05
209 0.05
210 0.05
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.03
217 0.03
218 0.03
219 0.03
220 0.05
221 0.07
222 0.08
223 0.08
224 0.08
225 0.08
226 0.1
227 0.11
228 0.1
229 0.12
230 0.13
231 0.17
232 0.21
233 0.21
234 0.21
235 0.2
236 0.21
237 0.23
238 0.26
239 0.32
240 0.28
241 0.33
242 0.34
243 0.35
244 0.35
245 0.34
246 0.3
247 0.24
248 0.23
249 0.19
250 0.17
251 0.15
252 0.14
253 0.1
254 0.1
255 0.07
256 0.07
257 0.07
258 0.08
259 0.09
260 0.11
261 0.14
262 0.17
263 0.19
264 0.21
265 0.22
266 0.21
267 0.2
268 0.19
269 0.16
270 0.15
271 0.15
272 0.13
273 0.13
274 0.17
275 0.17
276 0.17
277 0.17
278 0.15
279 0.16
280 0.22
281 0.23
282 0.27
283 0.35
284 0.44
285 0.48
286 0.5
287 0.49
288 0.45
289 0.44
290 0.36
291 0.29
292 0.2
293 0.17
294 0.13
295 0.13
296 0.1
297 0.09
298 0.08
299 0.06
300 0.06
301 0.04
302 0.04
303 0.05
304 0.04
305 0.04
306 0.05
307 0.06
308 0.07
309 0.08
310 0.09
311 0.11
312 0.12
313 0.13
314 0.17
315 0.22
316 0.24
317 0.34
318 0.36
319 0.38
320 0.4
321 0.42
322 0.38
323 0.34
324 0.33
325 0.26
326 0.24
327 0.2
328 0.17
329 0.16
330 0.17
331 0.16
332 0.12
333 0.12
334 0.13
335 0.15
336 0.16
337 0.16
338 0.19
339 0.21
340 0.21
341 0.23
342 0.23
343 0.28
344 0.32
345 0.35
346 0.37
347 0.36
348 0.38
349 0.36
350 0.39
351 0.34
352 0.29
353 0.24
354 0.18
355 0.18
356 0.15
357 0.15
358 0.09
359 0.07
360 0.07
361 0.07
362 0.07
363 0.06
364 0.06
365 0.09
366 0.09
367 0.12
368 0.15
369 0.2
370 0.22
371 0.22
372 0.22
373 0.21
374 0.24
375 0.24
376 0.22
377 0.23
378 0.25
379 0.28
380 0.35
381 0.36
382 0.37
383 0.44
384 0.49
385 0.49
386 0.57
387 0.62
388 0.66
389 0.74
390 0.77
391 0.79
392 0.82
393 0.86
394 0.87
395 0.87
396 0.87
397 0.88
398 0.89
399 0.84
400 0.85
401 0.85
402 0.81
403 0.76
404 0.7
405 0.65
406 0.6
407 0.56
408 0.49
409 0.42
410 0.35
411 0.31
412 0.26
413 0.2
414 0.15
415 0.12
416 0.08
417 0.05
418 0.04
419 0.04
420 0.04
421 0.04
422 0.04