Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RZV1

Protein Details
Accession A0A0J8RZV1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSMSMETWKKRKRRRDRSAVCGGDVHydrophilic
NLS Segment(s)
PositionSequence
9-16KKRKRRRD
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
Amino Acid Sequences MSMSMETWKKRKRRRDRSAVCGGDVGDVGGAETVCCDWRRSEPHRPKALVTNAGADQLGGGAGLLPDWVAPSGPFLKWAVSIRFRWDLVTASNGAVKSLVRDKRSMLRCAVCCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.9
3 0.91
4 0.9
5 0.91
6 0.83
7 0.72
8 0.62
9 0.51
10 0.4
11 0.31
12 0.21
13 0.1
14 0.07
15 0.06
16 0.05
17 0.05
18 0.03
19 0.04
20 0.04
21 0.06
22 0.07
23 0.08
24 0.09
25 0.15
26 0.23
27 0.3
28 0.41
29 0.49
30 0.58
31 0.65
32 0.65
33 0.61
34 0.61
35 0.59
36 0.52
37 0.42
38 0.35
39 0.27
40 0.26
41 0.24
42 0.16
43 0.11
44 0.07
45 0.06
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.03
57 0.03
58 0.06
59 0.08
60 0.08
61 0.09
62 0.1
63 0.1
64 0.13
65 0.17
66 0.2
67 0.22
68 0.24
69 0.28
70 0.31
71 0.3
72 0.29
73 0.26
74 0.23
75 0.2
76 0.22
77 0.17
78 0.15
79 0.17
80 0.16
81 0.15
82 0.14
83 0.12
84 0.14
85 0.21
86 0.27
87 0.27
88 0.29
89 0.33
90 0.42
91 0.49
92 0.49
93 0.48
94 0.5