Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8RHP9

Protein Details
Accession A0A0J8RHP9    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
158-178AVSTINSPRRVRRRKDPTPYKHydrophilic
NLS Segment(s)
PositionSequence
46-70RRAKSSEKVGDRKPSGKMSKKVLKE
167-172RVRRRK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MAPTPAAPRTPGRSPPPDTLPAAGENGNSNNAQANATRRTSLGFLRRAKSSEKVGDRKPSGKMSKKVLKEQAKEEQLRRQREAAISKFAPQLPDIAPPPQLNTFGGENVRSNLSGRAGSYEPLSAQSHPPVPPIPFVDVYGKAESMAHRGRYSYASSAVSTINSPRRVRRRKDPTPYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.6
4 0.59
5 0.54
6 0.48
7 0.42
8 0.36
9 0.32
10 0.27
11 0.21
12 0.19
13 0.18
14 0.18
15 0.16
16 0.14
17 0.14
18 0.14
19 0.15
20 0.15
21 0.18
22 0.21
23 0.23
24 0.23
25 0.21
26 0.22
27 0.24
28 0.27
29 0.3
30 0.33
31 0.37
32 0.39
33 0.41
34 0.42
35 0.43
36 0.41
37 0.4
38 0.4
39 0.43
40 0.47
41 0.5
42 0.56
43 0.57
44 0.56
45 0.53
46 0.53
47 0.54
48 0.56
49 0.56
50 0.56
51 0.6
52 0.61
53 0.65
54 0.66
55 0.66
56 0.6
57 0.61
58 0.6
59 0.59
60 0.59
61 0.54
62 0.53
63 0.52
64 0.53
65 0.5
66 0.43
67 0.38
68 0.38
69 0.42
70 0.36
71 0.34
72 0.29
73 0.29
74 0.3
75 0.28
76 0.24
77 0.18
78 0.18
79 0.13
80 0.16
81 0.15
82 0.13
83 0.15
84 0.14
85 0.16
86 0.15
87 0.16
88 0.13
89 0.14
90 0.14
91 0.13
92 0.14
93 0.13
94 0.12
95 0.12
96 0.13
97 0.11
98 0.11
99 0.11
100 0.11
101 0.11
102 0.1
103 0.13
104 0.13
105 0.13
106 0.13
107 0.12
108 0.11
109 0.14
110 0.15
111 0.13
112 0.14
113 0.17
114 0.2
115 0.19
116 0.22
117 0.21
118 0.21
119 0.22
120 0.23
121 0.24
122 0.21
123 0.22
124 0.24
125 0.23
126 0.25
127 0.24
128 0.21
129 0.18
130 0.18
131 0.17
132 0.2
133 0.23
134 0.23
135 0.22
136 0.23
137 0.25
138 0.27
139 0.3
140 0.26
141 0.24
142 0.23
143 0.23
144 0.23
145 0.22
146 0.2
147 0.18
148 0.22
149 0.26
150 0.32
151 0.35
152 0.44
153 0.54
154 0.63
155 0.7
156 0.74
157 0.77
158 0.81