Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8RFH3

Protein Details
Accession A0A0J8RFH3    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
82-104ELKALKGADKESRRRRRRRSRSABasic
NLS Segment(s)
PositionSequence
71-104ERKEWEEERKKELKALKGADKESRRRRRRRSRSA
Subcellular Location(s) nucl 16.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MLRDTSRGWKPHGILPHSWTFATRTQDIPAKDVWGNEDPGRREREKMRIDANDPLAAMKMGVRQLRDVEKERKEWEEERKKELKALKGADKESRRRRRRRSRSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.47
4 0.43
5 0.4
6 0.36
7 0.3
8 0.31
9 0.33
10 0.29
11 0.25
12 0.26
13 0.31
14 0.31
15 0.3
16 0.25
17 0.23
18 0.22
19 0.21
20 0.22
21 0.19
22 0.21
23 0.21
24 0.25
25 0.24
26 0.27
27 0.32
28 0.29
29 0.31
30 0.32
31 0.39
32 0.39
33 0.4
34 0.42
35 0.39
36 0.4
37 0.41
38 0.38
39 0.29
40 0.25
41 0.21
42 0.16
43 0.13
44 0.1
45 0.07
46 0.07
47 0.1
48 0.12
49 0.12
50 0.13
51 0.16
52 0.2
53 0.24
54 0.28
55 0.33
56 0.36
57 0.39
58 0.41
59 0.41
60 0.42
61 0.43
62 0.48
63 0.51
64 0.51
65 0.55
66 0.58
67 0.55
68 0.56
69 0.57
70 0.53
71 0.5
72 0.53
73 0.54
74 0.54
75 0.57
76 0.61
77 0.63
78 0.66
79 0.69
80 0.74
81 0.76
82 0.8
83 0.88
84 0.9