Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RSU3

Protein Details
Accession A0A0J8RSU3   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
172-200WGLPAKSGYRTRPKRKVNKAVVTPRERNQHydrophilic
NLS Segment(s)
PositionSequence
129-136GKAGRKRW
156-206GGGRGKSKGNVDPKSPWGLPAKSGYRTRPKRKVNKAVVTPRERNQGKRRRG
Subcellular Location(s) cyto 14, mito 9, nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR014722  Rib_L2_dom2  
IPR002171  Ribosomal_L2  
IPR022669  Ribosomal_L2_C  
IPR014726  Ribosomal_L2_dom3  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF03947  Ribosomal_L2_C  
Amino Acid Sequences MGGVIDPGVLAAKTAWRGNCLPLHMIPIGTLIYNVGLHKDKGAQLCRSAGTFATVIAKSVEGYDPEADTITDEKGEVKHLTLQDKHRLKKLSEHVTLRLKSGEIRLIHKNCCATIGIASNANHQYRRLGKAGRKRWLGIRPTVRGLAMNAMDHPHGGGRGKSKGNVDPKSPWGLPAKSGYRTRPKRKVNKAVVTPRERNQGKRRRGYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.21
4 0.23
5 0.27
6 0.31
7 0.3
8 0.31
9 0.27
10 0.31
11 0.27
12 0.26
13 0.2
14 0.18
15 0.16
16 0.12
17 0.11
18 0.07
19 0.07
20 0.08
21 0.08
22 0.11
23 0.12
24 0.13
25 0.14
26 0.17
27 0.2
28 0.25
29 0.31
30 0.3
31 0.3
32 0.32
33 0.32
34 0.29
35 0.27
36 0.2
37 0.17
38 0.14
39 0.12
40 0.14
41 0.13
42 0.13
43 0.13
44 0.13
45 0.1
46 0.11
47 0.12
48 0.08
49 0.1
50 0.1
51 0.1
52 0.1
53 0.1
54 0.09
55 0.09
56 0.09
57 0.08
58 0.07
59 0.07
60 0.07
61 0.08
62 0.11
63 0.1
64 0.1
65 0.14
66 0.16
67 0.21
68 0.25
69 0.29
70 0.36
71 0.43
72 0.44
73 0.46
74 0.47
75 0.43
76 0.47
77 0.51
78 0.51
79 0.49
80 0.49
81 0.49
82 0.53
83 0.52
84 0.44
85 0.36
86 0.27
87 0.22
88 0.21
89 0.21
90 0.15
91 0.18
92 0.25
93 0.27
94 0.28
95 0.29
96 0.28
97 0.23
98 0.23
99 0.2
100 0.13
101 0.12
102 0.12
103 0.11
104 0.14
105 0.14
106 0.17
107 0.2
108 0.2
109 0.19
110 0.18
111 0.22
112 0.22
113 0.26
114 0.26
115 0.29
116 0.34
117 0.44
118 0.52
119 0.55
120 0.54
121 0.53
122 0.56
123 0.58
124 0.56
125 0.54
126 0.53
127 0.48
128 0.48
129 0.47
130 0.4
131 0.33
132 0.29
133 0.25
134 0.18
135 0.15
136 0.13
137 0.13
138 0.13
139 0.12
140 0.12
141 0.08
142 0.09
143 0.1
144 0.12
145 0.15
146 0.21
147 0.23
148 0.26
149 0.3
150 0.35
151 0.43
152 0.45
153 0.45
154 0.44
155 0.46
156 0.49
157 0.45
158 0.42
159 0.39
160 0.37
161 0.35
162 0.39
163 0.4
164 0.4
165 0.45
166 0.49
167 0.54
168 0.63
169 0.71
170 0.73
171 0.79
172 0.83
173 0.89
174 0.92
175 0.91
176 0.91
177 0.91
178 0.91
179 0.9
180 0.88
181 0.84
182 0.79
183 0.79
184 0.73
185 0.72
186 0.72
187 0.73
188 0.74