Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RNR3

Protein Details
Accession A0A0J8RNR3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
108-134IFEKYWTKPSRKKGQPQPATPNPPKESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037651  Swc3  
Gene Ontology GO:0000812  C:Swr1 complex  
GO:0140849  F:ATP-dependent H2AZ histone chaperone activity  
Amino Acid Sequences MSGPCDEMAEKRKLRAPPTTRTRKSDATTPQRQVPAKRKASATPAPKLPEAVEEEPLPTKIKEGNPLPTLAKVQPGNLSLRDYQPYDESAVVVAALRRSQTRWLHECIFEKYWTKPSRKKGQPQPATPNPPKESMTKLGPVYNCD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.53
4 0.55
5 0.64
6 0.71
7 0.71
8 0.72
9 0.73
10 0.7
11 0.67
12 0.65
13 0.65
14 0.63
15 0.66
16 0.64
17 0.64
18 0.63
19 0.64
20 0.64
21 0.63
22 0.64
23 0.61
24 0.61
25 0.58
26 0.55
27 0.59
28 0.58
29 0.54
30 0.49
31 0.48
32 0.46
33 0.44
34 0.41
35 0.34
36 0.29
37 0.29
38 0.25
39 0.21
40 0.18
41 0.19
42 0.19
43 0.2
44 0.18
45 0.12
46 0.11
47 0.14
48 0.15
49 0.21
50 0.22
51 0.27
52 0.27
53 0.29
54 0.28
55 0.25
56 0.25
57 0.19
58 0.21
59 0.15
60 0.15
61 0.15
62 0.16
63 0.17
64 0.16
65 0.18
66 0.15
67 0.16
68 0.18
69 0.16
70 0.16
71 0.15
72 0.15
73 0.14
74 0.13
75 0.11
76 0.09
77 0.09
78 0.07
79 0.07
80 0.06
81 0.05
82 0.06
83 0.07
84 0.08
85 0.09
86 0.17
87 0.22
88 0.29
89 0.33
90 0.37
91 0.4
92 0.44
93 0.46
94 0.44
95 0.41
96 0.37
97 0.35
98 0.33
99 0.39
100 0.41
101 0.46
102 0.48
103 0.55
104 0.64
105 0.71
106 0.78
107 0.8
108 0.84
109 0.86
110 0.87
111 0.87
112 0.86
113 0.87
114 0.83
115 0.81
116 0.73
117 0.68
118 0.61
119 0.54
120 0.51
121 0.46
122 0.45
123 0.42
124 0.41
125 0.42