Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P6Q5I6

Protein Details
Accession A0A0P6Q5I6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
96-115NDSHRPVRGHRRSSQARRPGBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039295  MSB2  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0005034  F:osmosensor activity  
GO:0007232  P:osmosensory signaling pathway via Sho1 osmosensor  
Amino Acid Sequences MGVAYALEIPNESVKVGALRPYDTVARLGYTTTVASVYIPSDLIQSLALQLRTPSSRLYNNPDPSVRTIMAMFVPTIPFTRVLSGGMGSPSNPGENDSHRPVRGHRRSSQARRPGTGRGGGSYLLRASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.12
4 0.16
5 0.15
6 0.16
7 0.17
8 0.2
9 0.21
10 0.2
11 0.21
12 0.16
13 0.16
14 0.14
15 0.14
16 0.12
17 0.11
18 0.1
19 0.09
20 0.08
21 0.07
22 0.07
23 0.07
24 0.07
25 0.06
26 0.06
27 0.06
28 0.07
29 0.06
30 0.07
31 0.06
32 0.06
33 0.07
34 0.09
35 0.09
36 0.08
37 0.09
38 0.1
39 0.11
40 0.12
41 0.12
42 0.13
43 0.17
44 0.2
45 0.28
46 0.34
47 0.36
48 0.37
49 0.37
50 0.35
51 0.33
52 0.34
53 0.25
54 0.18
55 0.15
56 0.13
57 0.13
58 0.11
59 0.09
60 0.06
61 0.07
62 0.06
63 0.07
64 0.07
65 0.08
66 0.08
67 0.09
68 0.09
69 0.1
70 0.1
71 0.09
72 0.09
73 0.09
74 0.09
75 0.08
76 0.09
77 0.09
78 0.09
79 0.09
80 0.1
81 0.12
82 0.16
83 0.22
84 0.27
85 0.31
86 0.32
87 0.34
88 0.38
89 0.47
90 0.52
91 0.54
92 0.53
93 0.59
94 0.69
95 0.77
96 0.81
97 0.79
98 0.75
99 0.73
100 0.7
101 0.66
102 0.61
103 0.57
104 0.49
105 0.41
106 0.38
107 0.34
108 0.32
109 0.27