Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3J7R2

Protein Details
Accession G3J7R2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
134-157QVEIEVRRARKRRAKAISNRDLTHHydrophilic
NLS Segment(s)
PositionSequence
140-148RRARKRRAK
Subcellular Location(s) cyto_nucl 10.5, nucl 10, cyto 9, mito 4, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR040357  Vma22/CCDC115  
Gene Ontology GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
KEGG cmt:CCM_00982  -  
Amino Acid Sequences MASEADQAIDGLLERYLVLVDQYAALRASLSAAQQRTFHALARARFTVDRGGGVGRNQYDERMQASRRVVVSRPAAAPPTFAVTAEGHNAAGNNPLRWFGVLVPQALRDAQSEAVRTVEDILPRLASVQAGMAQVEIEVRRARKRRAKAISNRDLTHTNKNSGSGHNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.07
9 0.07
10 0.08
11 0.08
12 0.08
13 0.08
14 0.08
15 0.09
16 0.09
17 0.1
18 0.15
19 0.16
20 0.18
21 0.19
22 0.21
23 0.24
24 0.24
25 0.23
26 0.24
27 0.28
28 0.29
29 0.33
30 0.32
31 0.3
32 0.29
33 0.29
34 0.27
35 0.22
36 0.2
37 0.16
38 0.16
39 0.15
40 0.16
41 0.18
42 0.13
43 0.16
44 0.16
45 0.16
46 0.16
47 0.16
48 0.18
49 0.18
50 0.19
51 0.2
52 0.22
53 0.24
54 0.24
55 0.25
56 0.23
57 0.25
58 0.26
59 0.24
60 0.23
61 0.21
62 0.22
63 0.2
64 0.19
65 0.14
66 0.15
67 0.12
68 0.11
69 0.12
70 0.1
71 0.11
72 0.11
73 0.11
74 0.08
75 0.08
76 0.08
77 0.06
78 0.11
79 0.11
80 0.11
81 0.11
82 0.11
83 0.11
84 0.11
85 0.12
86 0.07
87 0.13
88 0.14
89 0.15
90 0.15
91 0.15
92 0.15
93 0.15
94 0.15
95 0.09
96 0.09
97 0.11
98 0.12
99 0.12
100 0.12
101 0.13
102 0.12
103 0.11
104 0.12
105 0.12
106 0.11
107 0.12
108 0.12
109 0.11
110 0.11
111 0.12
112 0.1
113 0.08
114 0.07
115 0.07
116 0.08
117 0.09
118 0.09
119 0.08
120 0.07
121 0.07
122 0.09
123 0.09
124 0.09
125 0.13
126 0.16
127 0.25
128 0.32
129 0.42
130 0.49
131 0.58
132 0.66
133 0.73
134 0.8
135 0.82
136 0.87
137 0.87
138 0.85
139 0.78
140 0.71
141 0.67
142 0.61
143 0.61
144 0.55
145 0.5
146 0.44
147 0.47
148 0.45