Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RJ34

Protein Details
Accession A0A0J8RJ34   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-96LPTLRLKTRRHKTVLHRPVRBasic
NLS Segment(s)
Subcellular Location(s) mito 14, extr 7, mito_nucl 7
Family & Domain DBs
Amino Acid Sequences MRSLGVPAAGGACLERARISTLPLGEGRNLIVALPALPGSSARGVTSDYLRGARWFRVRGNVSCEAELVMALRGLELPTLRLKTRRHKTVLHRPVRCAVPSLWWDHSPLCA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.13
5 0.13
6 0.15
7 0.17
8 0.18
9 0.2
10 0.21
11 0.21
12 0.18
13 0.18
14 0.16
15 0.13
16 0.12
17 0.1
18 0.08
19 0.07
20 0.06
21 0.06
22 0.06
23 0.04
24 0.05
25 0.05
26 0.06
27 0.07
28 0.07
29 0.06
30 0.07
31 0.08
32 0.09
33 0.1
34 0.1
35 0.1
36 0.11
37 0.11
38 0.13
39 0.13
40 0.16
41 0.19
42 0.2
43 0.2
44 0.27
45 0.3
46 0.3
47 0.35
48 0.37
49 0.34
50 0.32
51 0.31
52 0.23
53 0.2
54 0.18
55 0.12
56 0.06
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.06
65 0.1
66 0.13
67 0.15
68 0.21
69 0.27
70 0.37
71 0.47
72 0.54
73 0.56
74 0.62
75 0.7
76 0.76
77 0.8
78 0.8
79 0.74
80 0.7
81 0.71
82 0.68
83 0.58
84 0.51
85 0.41
86 0.38
87 0.37
88 0.38
89 0.36
90 0.33
91 0.34