Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8S250

Protein Details
Accession A0A0J8S250    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
64-89SSSHGPKQPSKVRKPQRKTTTTKSRDHydrophilic
NLS Segment(s)
PositionSequence
54-58KGKSK
67-81HGPKQPSKVRKPQRK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MALNSESSSKGKGTLVECRSSTQAASSTDSGGKGTAVESRSLTETASSTNHKGKGKSKTPNSTSSSHGPKQPSKVRKPQRKTTTTKSRDIQRRIGFVGPNDMIVVQPHRSIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.35
4 0.36
5 0.36
6 0.37
7 0.33
8 0.3
9 0.23
10 0.23
11 0.2
12 0.23
13 0.21
14 0.21
15 0.21
16 0.21
17 0.19
18 0.15
19 0.12
20 0.09
21 0.08
22 0.1
23 0.1
24 0.11
25 0.11
26 0.12
27 0.14
28 0.14
29 0.13
30 0.1
31 0.1
32 0.1
33 0.12
34 0.13
35 0.14
36 0.18
37 0.23
38 0.25
39 0.28
40 0.33
41 0.4
42 0.45
43 0.51
44 0.55
45 0.58
46 0.6
47 0.64
48 0.61
49 0.55
50 0.51
51 0.49
52 0.48
53 0.42
54 0.42
55 0.4
56 0.4
57 0.46
58 0.51
59 0.54
60 0.56
61 0.64
62 0.7
63 0.76
64 0.81
65 0.83
66 0.84
67 0.84
68 0.83
69 0.83
70 0.84
71 0.79
72 0.79
73 0.74
74 0.74
75 0.75
76 0.73
77 0.72
78 0.66
79 0.65
80 0.6
81 0.58
82 0.51
83 0.42
84 0.44
85 0.34
86 0.29
87 0.25
88 0.22
89 0.18
90 0.18
91 0.2
92 0.14