Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8S0F0

Protein Details
Accession A0A0J8S0F0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
272-293GSRDAKRYRRDVRDADRFRREKBasic
NLS Segment(s)
PositionSequence
276-305AKRYRRDVRDADRFRREKDRERLPARSPRK
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036517  FF_domain_sf  
Amino Acid Sequences MLTDRRTDRIDHETLNLIFHRLRDKVLRRTEDEKHAANRHQRRAVDALRSRIRRLDPPVHASDTWEQVKQRIDKTEEYRAVESDELRILAFEKVVRRLKEKEEDAERDRDRVAKREYYDRFDRLDRGERSHRSTQSYRTEKRGTSSRLSRTPEPDAYEADRRKAQADRERSYRKASGLSPSPVSHRDRDRDRGRERERERDWDRVSSRLVSHYDRDRRDWDEERERLYPSRADPRSSRDELDYGVGDITRGAPGQVLSERRRRRDSETESVGSRDAKRYRRDVRDADRFRREKDRERLPARSPRKDDSDKASSGPSAHKETAAVHSGSEEGEIEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.34
4 0.29
5 0.26
6 0.26
7 0.29
8 0.24
9 0.28
10 0.34
11 0.42
12 0.49
13 0.58
14 0.62
15 0.62
16 0.67
17 0.7
18 0.69
19 0.67
20 0.63
21 0.61
22 0.62
23 0.63
24 0.67
25 0.69
26 0.69
27 0.7
28 0.65
29 0.62
30 0.63
31 0.61
32 0.61
33 0.57
34 0.58
35 0.59
36 0.61
37 0.59
38 0.57
39 0.55
40 0.52
41 0.54
42 0.55
43 0.52
44 0.56
45 0.59
46 0.57
47 0.53
48 0.5
49 0.45
50 0.42
51 0.38
52 0.34
53 0.3
54 0.3
55 0.36
56 0.37
57 0.38
58 0.39
59 0.41
60 0.45
61 0.5
62 0.56
63 0.54
64 0.53
65 0.49
66 0.43
67 0.41
68 0.35
69 0.29
70 0.21
71 0.17
72 0.14
73 0.12
74 0.12
75 0.11
76 0.1
77 0.1
78 0.11
79 0.13
80 0.2
81 0.27
82 0.29
83 0.32
84 0.36
85 0.41
86 0.47
87 0.48
88 0.47
89 0.48
90 0.52
91 0.52
92 0.56
93 0.5
94 0.43
95 0.41
96 0.4
97 0.35
98 0.36
99 0.37
100 0.34
101 0.36
102 0.44
103 0.47
104 0.47
105 0.51
106 0.46
107 0.44
108 0.4
109 0.41
110 0.36
111 0.41
112 0.36
113 0.37
114 0.42
115 0.43
116 0.48
117 0.52
118 0.51
119 0.48
120 0.49
121 0.51
122 0.53
123 0.58
124 0.55
125 0.54
126 0.56
127 0.5
128 0.51
129 0.51
130 0.46
131 0.43
132 0.48
133 0.47
134 0.49
135 0.53
136 0.52
137 0.48
138 0.48
139 0.44
140 0.4
141 0.35
142 0.3
143 0.29
144 0.33
145 0.3
146 0.27
147 0.27
148 0.24
149 0.25
150 0.26
151 0.29
152 0.3
153 0.37
154 0.39
155 0.45
156 0.5
157 0.5
158 0.51
159 0.47
160 0.4
161 0.35
162 0.32
163 0.29
164 0.29
165 0.29
166 0.26
167 0.25
168 0.26
169 0.27
170 0.29
171 0.28
172 0.29
173 0.33
174 0.36
175 0.45
176 0.5
177 0.55
178 0.58
179 0.63
180 0.65
181 0.68
182 0.67
183 0.68
184 0.64
185 0.64
186 0.62
187 0.61
188 0.57
189 0.54
190 0.51
191 0.44
192 0.43
193 0.35
194 0.33
195 0.28
196 0.28
197 0.23
198 0.26
199 0.32
200 0.38
201 0.38
202 0.41
203 0.41
204 0.42
205 0.46
206 0.47
207 0.47
208 0.48
209 0.48
210 0.49
211 0.47
212 0.45
213 0.4
214 0.37
215 0.32
216 0.27
217 0.34
218 0.32
219 0.34
220 0.35
221 0.4
222 0.45
223 0.44
224 0.42
225 0.34
226 0.33
227 0.3
228 0.3
229 0.23
230 0.16
231 0.14
232 0.12
233 0.09
234 0.08
235 0.08
236 0.06
237 0.06
238 0.05
239 0.06
240 0.06
241 0.09
242 0.13
243 0.19
244 0.23
245 0.33
246 0.41
247 0.47
248 0.53
249 0.55
250 0.59
251 0.63
252 0.66
253 0.66
254 0.66
255 0.62
256 0.57
257 0.54
258 0.48
259 0.41
260 0.36
261 0.34
262 0.34
263 0.39
264 0.44
265 0.52
266 0.61
267 0.66
268 0.72
269 0.73
270 0.75
271 0.79
272 0.81
273 0.81
274 0.81
275 0.76
276 0.72
277 0.73
278 0.71
279 0.7
280 0.71
281 0.73
282 0.72
283 0.76
284 0.79
285 0.76
286 0.8
287 0.79
288 0.8
289 0.75
290 0.71
291 0.74
292 0.73
293 0.7
294 0.68
295 0.66
296 0.57
297 0.53
298 0.49
299 0.42
300 0.37
301 0.38
302 0.35
303 0.34
304 0.33
305 0.32
306 0.31
307 0.32
308 0.35
309 0.34
310 0.29
311 0.21
312 0.21
313 0.21
314 0.2
315 0.18
316 0.13