Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8RD37

Protein Details
Accession A0A0J8RD37    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-81ETCGPRKREPDLKQRARRTRLLBasic
NLS Segment(s)
PositionSequence
66-79KREPDLKQRARRTR
Subcellular Location(s) cyto 11.5, cyto_nucl 10.5, nucl 8.5, mito 4
Family & Domain DBs
Amino Acid Sequences MATWASTTGQPEEKTDRAVRESAPSGLAHIKLRQSDIADRPIELKAVTAGTLAITLCSAETCGPRKREPDLKQRARRTRLLIGRALKNLKRSLDMFLLSAGGRKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.36
4 0.34
5 0.35
6 0.32
7 0.31
8 0.32
9 0.27
10 0.25
11 0.21
12 0.21
13 0.21
14 0.22
15 0.18
16 0.19
17 0.2
18 0.2
19 0.22
20 0.21
21 0.21
22 0.25
23 0.26
24 0.29
25 0.26
26 0.26
27 0.26
28 0.24
29 0.22
30 0.16
31 0.13
32 0.08
33 0.07
34 0.07
35 0.05
36 0.05
37 0.04
38 0.05
39 0.05
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.04
46 0.04
47 0.07
48 0.12
49 0.18
50 0.22
51 0.25
52 0.28
53 0.33
54 0.42
55 0.47
56 0.53
57 0.59
58 0.66
59 0.73
60 0.8
61 0.84
62 0.8
63 0.79
64 0.74
65 0.73
66 0.69
67 0.65
68 0.62
69 0.59
70 0.58
71 0.58
72 0.59
73 0.53
74 0.51
75 0.51
76 0.46
77 0.44
78 0.4
79 0.39
80 0.36
81 0.34
82 0.29
83 0.24
84 0.24
85 0.19