Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8S735

Protein Details
Accession A0A0J8S735    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-109SVSPSKRMTRSRRPLKPKQEVEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR038872  Put_GTT3  
Amino Acid Sequences MTAALPYLRALRKSDLLVLAEVSDLKDYDDYKKPELEAALDEHLSANRTTLSKEQRLSDYYRRLLQPPRSSPIKREPKPDGPSGLDDSVSPSKRMTRSRRPLKPKQEVEATDESESGSASQASRSPSASAMEAHTPSRPALGFLSSLPPSPAVVTVAIEEQTTKVRKSVSDAWVASGLKERAYALRSCLSSVSTIESLILMLEIYGLGSEILPFRYLTTIPPQRISILPPSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.32
4 0.3
5 0.27
6 0.22
7 0.19
8 0.17
9 0.13
10 0.1
11 0.08
12 0.09
13 0.1
14 0.12
15 0.17
16 0.25
17 0.29
18 0.31
19 0.33
20 0.33
21 0.33
22 0.33
23 0.29
24 0.23
25 0.22
26 0.21
27 0.19
28 0.18
29 0.16
30 0.16
31 0.15
32 0.13
33 0.11
34 0.1
35 0.11
36 0.13
37 0.2
38 0.27
39 0.31
40 0.34
41 0.36
42 0.38
43 0.4
44 0.45
45 0.46
46 0.46
47 0.44
48 0.46
49 0.45
50 0.46
51 0.51
52 0.53
53 0.54
54 0.51
55 0.54
56 0.56
57 0.56
58 0.57
59 0.6
60 0.62
61 0.56
62 0.58
63 0.6
64 0.62
65 0.65
66 0.63
67 0.56
68 0.48
69 0.47
70 0.43
71 0.36
72 0.26
73 0.21
74 0.22
75 0.24
76 0.23
77 0.2
78 0.17
79 0.22
80 0.27
81 0.36
82 0.4
83 0.45
84 0.55
85 0.65
86 0.74
87 0.78
88 0.83
89 0.85
90 0.86
91 0.8
92 0.73
93 0.7
94 0.61
95 0.58
96 0.51
97 0.42
98 0.32
99 0.28
100 0.23
101 0.17
102 0.15
103 0.09
104 0.06
105 0.05
106 0.04
107 0.05
108 0.07
109 0.09
110 0.1
111 0.11
112 0.11
113 0.12
114 0.13
115 0.13
116 0.11
117 0.11
118 0.12
119 0.13
120 0.13
121 0.12
122 0.12
123 0.12
124 0.12
125 0.11
126 0.1
127 0.09
128 0.1
129 0.1
130 0.1
131 0.14
132 0.13
133 0.13
134 0.12
135 0.12
136 0.11
137 0.11
138 0.11
139 0.07
140 0.07
141 0.07
142 0.08
143 0.08
144 0.08
145 0.07
146 0.07
147 0.07
148 0.12
149 0.14
150 0.14
151 0.15
152 0.16
153 0.17
154 0.23
155 0.31
156 0.29
157 0.35
158 0.35
159 0.35
160 0.38
161 0.37
162 0.31
163 0.29
164 0.25
165 0.18
166 0.18
167 0.17
168 0.16
169 0.19
170 0.2
171 0.17
172 0.22
173 0.22
174 0.23
175 0.23
176 0.2
177 0.19
178 0.19
179 0.19
180 0.14
181 0.14
182 0.13
183 0.12
184 0.11
185 0.1
186 0.09
187 0.04
188 0.03
189 0.04
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.04
196 0.05
197 0.06
198 0.07
199 0.08
200 0.08
201 0.09
202 0.12
203 0.12
204 0.15
205 0.24
206 0.32
207 0.34
208 0.37
209 0.38
210 0.38
211 0.4
212 0.41