Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8S759

Protein Details
Accession A0A0J8S759    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
129-149PFPRSTRRSAPPSPSRRRFSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11.5, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045128  PI31-like  
IPR021625  PI31_Prot_N  
Gene Ontology GO:0000502  C:proteasome complex  
GO:0004866  F:endopeptidase inhibitor activity  
GO:0070628  F:proteasome binding  
GO:0043161  P:proteasome-mediated ubiquitin-dependent protein catabolic process  
GO:0019222  P:regulation of metabolic process  
Pfam View protein in Pfam  
PF11566  PI31_Prot_N  
Amino Acid Sequences MQFILKVIQLGNNAVVSAIALGDDRTASFDIFVRDYVSLSSLPISPSSDLLDTLNRVFISPERLKDLISLFRINVIQKLAPGLQKEGYEDTSQGAGGASRRRQEEVEDRRPPRDPLRDDRFPPPVQPIPFPRSTRRSAPPSPSRRRFSTSGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.09
4 0.07
5 0.05
6 0.04
7 0.04
8 0.04
9 0.04
10 0.05
11 0.05
12 0.07
13 0.08
14 0.08
15 0.09
16 0.11
17 0.13
18 0.13
19 0.14
20 0.13
21 0.12
22 0.13
23 0.12
24 0.12
25 0.1
26 0.09
27 0.1
28 0.09
29 0.1
30 0.1
31 0.11
32 0.1
33 0.11
34 0.12
35 0.11
36 0.11
37 0.11
38 0.12
39 0.11
40 0.11
41 0.12
42 0.11
43 0.1
44 0.1
45 0.1
46 0.17
47 0.18
48 0.19
49 0.22
50 0.22
51 0.22
52 0.23
53 0.24
54 0.2
55 0.2
56 0.2
57 0.15
58 0.16
59 0.17
60 0.16
61 0.15
62 0.12
63 0.1
64 0.09
65 0.11
66 0.11
67 0.11
68 0.12
69 0.12
70 0.13
71 0.13
72 0.14
73 0.14
74 0.15
75 0.13
76 0.13
77 0.12
78 0.11
79 0.1
80 0.09
81 0.07
82 0.06
83 0.08
84 0.13
85 0.15
86 0.18
87 0.2
88 0.21
89 0.22
90 0.26
91 0.34
92 0.39
93 0.47
94 0.52
95 0.53
96 0.55
97 0.57
98 0.56
99 0.54
100 0.54
101 0.5
102 0.51
103 0.58
104 0.62
105 0.63
106 0.65
107 0.64
108 0.55
109 0.51
110 0.49
111 0.47
112 0.42
113 0.44
114 0.45
115 0.44
116 0.51
117 0.53
118 0.54
119 0.53
120 0.56
121 0.58
122 0.59
123 0.61
124 0.61
125 0.67
126 0.7
127 0.74
128 0.8
129 0.82
130 0.8
131 0.78
132 0.77