Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8S5V7

Protein Details
Accession A0A0J8S5V7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
18-37WRLSSMQKARQRKRLRAVDKHydrophilic
79-100FDRKEKTYRKGIHKLPKWTRVSBasic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSPVMGGLLWKIPWRLSSMQKARQRKRLRAVDKVVDTVNAALQRNGGKSAKAVERWYSEMPREEEMLPKDKYTIFDRKEKTYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.15
5 0.19
6 0.23
7 0.27
8 0.37
9 0.44
10 0.52
11 0.6
12 0.69
13 0.72
14 0.77
15 0.8
16 0.78
17 0.8
18 0.81
19 0.79
20 0.78
21 0.77
22 0.74
23 0.67
24 0.6
25 0.5
26 0.39
27 0.33
28 0.24
29 0.19
30 0.14
31 0.12
32 0.1
33 0.12
34 0.12
35 0.13
36 0.15
37 0.14
38 0.11
39 0.11
40 0.15
41 0.17
42 0.18
43 0.19
44 0.18
45 0.2
46 0.24
47 0.26
48 0.24
49 0.23
50 0.25
51 0.26
52 0.24
53 0.24
54 0.21
55 0.23
56 0.24
57 0.28
58 0.24
59 0.22
60 0.23
61 0.22
62 0.24
63 0.26
64 0.32
65 0.3
66 0.38
67 0.42
68 0.48
69 0.56
70 0.61
71 0.61
72 0.61
73 0.66
74 0.67
75 0.73
76 0.75
77 0.76
78 0.77
79 0.82
80 0.82
81 0.83
82 0.79
83 0.78
84 0.79
85 0.79
86 0.8
87 0.77
88 0.79