Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3J571

Protein Details
Accession G3J571   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
53-74AASASRTKRGKKPAHNSQRAAVHydrophilic
306-325QDIGRRRQRLRKNQANASISHydrophilic
NLS Segment(s)
PositionSequence
61-64RGKK
Subcellular Location(s) nucl 11cysk 11, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
KEGG cmt:CCM_00639  -  
Amino Acid Sequences MTVIQEPTNTEDLKVLIENLLERLPEAQRSPFLHSQLSRFGIRDTSSEPTELAASASRTKRGKKPAHNSQRAAVGDSPSPRSTSGTEPARDKEGHQCGFCKEMNHVVVCARKNDLKRHMGDFHHVVTEFRCPVQGCKFQTESKKQFSQHIKTDGRHKQIVSNNEIHNHEVTICEPIIFACGFANCSVLLEAPPAGDNGKTFRDYIEHVIKHYDEDQCAEWSYETRIQSLLRQSRMQGVAQHVDMRALVWDWKHSTELRRELITGNIMSKEETLQRAFSLGSGNYHMNNSQLQPMLTMRGRAAARGQDIGRRRQRLRKNQANASISSQYDFDPSYQTHVQLPESLVSSELVMRRSADPSLSPATYSGSVHNTPPTPLGDAMSQVYARGSQEVFMGAEAIHVDPRMHPGMPPQQGYAVQRELPSGFLMSNGFTMDSEQHFLQQGLNHQKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.17
3 0.13
4 0.14
5 0.14
6 0.14
7 0.15
8 0.13
9 0.12
10 0.15
11 0.16
12 0.19
13 0.21
14 0.23
15 0.28
16 0.31
17 0.39
18 0.4
19 0.41
20 0.44
21 0.44
22 0.44
23 0.45
24 0.46
25 0.4
26 0.36
27 0.35
28 0.32
29 0.31
30 0.29
31 0.26
32 0.27
33 0.26
34 0.26
35 0.24
36 0.21
37 0.2
38 0.18
39 0.15
40 0.12
41 0.13
42 0.2
43 0.22
44 0.28
45 0.33
46 0.39
47 0.47
48 0.55
49 0.63
50 0.66
51 0.74
52 0.79
53 0.85
54 0.88
55 0.83
56 0.76
57 0.74
58 0.64
59 0.57
60 0.48
61 0.4
62 0.34
63 0.34
64 0.35
65 0.28
66 0.28
67 0.25
68 0.25
69 0.25
70 0.26
71 0.32
72 0.34
73 0.37
74 0.39
75 0.41
76 0.43
77 0.41
78 0.38
79 0.39
80 0.41
81 0.42
82 0.39
83 0.4
84 0.37
85 0.41
86 0.4
87 0.32
88 0.25
89 0.28
90 0.3
91 0.28
92 0.27
93 0.25
94 0.29
95 0.29
96 0.29
97 0.25
98 0.27
99 0.32
100 0.4
101 0.45
102 0.47
103 0.49
104 0.53
105 0.55
106 0.52
107 0.52
108 0.47
109 0.4
110 0.35
111 0.32
112 0.26
113 0.21
114 0.24
115 0.2
116 0.17
117 0.18
118 0.16
119 0.2
120 0.27
121 0.33
122 0.32
123 0.36
124 0.39
125 0.42
126 0.51
127 0.56
128 0.56
129 0.56
130 0.58
131 0.54
132 0.6
133 0.64
134 0.62
135 0.59
136 0.61
137 0.59
138 0.56
139 0.65
140 0.64
141 0.6
142 0.56
143 0.5
144 0.47
145 0.48
146 0.51
147 0.46
148 0.45
149 0.41
150 0.41
151 0.42
152 0.36
153 0.31
154 0.25
155 0.2
156 0.14
157 0.13
158 0.11
159 0.1
160 0.08
161 0.08
162 0.07
163 0.09
164 0.08
165 0.08
166 0.06
167 0.06
168 0.07
169 0.07
170 0.08
171 0.06
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.05
179 0.06
180 0.05
181 0.06
182 0.06
183 0.06
184 0.08
185 0.1
186 0.11
187 0.11
188 0.11
189 0.12
190 0.14
191 0.19
192 0.25
193 0.23
194 0.22
195 0.24
196 0.24
197 0.23
198 0.24
199 0.21
200 0.13
201 0.14
202 0.15
203 0.14
204 0.14
205 0.14
206 0.11
207 0.09
208 0.12
209 0.14
210 0.14
211 0.13
212 0.14
213 0.14
214 0.17
215 0.24
216 0.26
217 0.25
218 0.25
219 0.25
220 0.3
221 0.31
222 0.29
223 0.23
224 0.21
225 0.21
226 0.2
227 0.21
228 0.16
229 0.14
230 0.13
231 0.1
232 0.08
233 0.06
234 0.07
235 0.06
236 0.08
237 0.09
238 0.1
239 0.12
240 0.14
241 0.18
242 0.24
243 0.29
244 0.3
245 0.29
246 0.29
247 0.28
248 0.27
249 0.25
250 0.18
251 0.14
252 0.13
253 0.12
254 0.12
255 0.11
256 0.11
257 0.11
258 0.13
259 0.13
260 0.13
261 0.12
262 0.13
263 0.13
264 0.12
265 0.12
266 0.09
267 0.1
268 0.12
269 0.13
270 0.13
271 0.13
272 0.13
273 0.12
274 0.13
275 0.13
276 0.14
277 0.14
278 0.13
279 0.14
280 0.14
281 0.17
282 0.16
283 0.16
284 0.13
285 0.18
286 0.18
287 0.18
288 0.2
289 0.19
290 0.2
291 0.22
292 0.23
293 0.23
294 0.28
295 0.36
296 0.42
297 0.46
298 0.5
299 0.56
300 0.65
301 0.71
302 0.77
303 0.78
304 0.78
305 0.79
306 0.82
307 0.76
308 0.68
309 0.62
310 0.54
311 0.44
312 0.36
313 0.29
314 0.21
315 0.19
316 0.17
317 0.13
318 0.13
319 0.13
320 0.18
321 0.19
322 0.2
323 0.21
324 0.22
325 0.23
326 0.22
327 0.23
328 0.18
329 0.18
330 0.17
331 0.15
332 0.13
333 0.13
334 0.13
335 0.14
336 0.14
337 0.13
338 0.15
339 0.16
340 0.18
341 0.18
342 0.16
343 0.15
344 0.18
345 0.22
346 0.2
347 0.19
348 0.17
349 0.2
350 0.2
351 0.2
352 0.18
353 0.19
354 0.2
355 0.22
356 0.26
357 0.24
358 0.23
359 0.25
360 0.24
361 0.21
362 0.2
363 0.2
364 0.17
365 0.17
366 0.18
367 0.17
368 0.15
369 0.13
370 0.13
371 0.12
372 0.12
373 0.13
374 0.12
375 0.11
376 0.11
377 0.13
378 0.12
379 0.11
380 0.11
381 0.08
382 0.08
383 0.08
384 0.09
385 0.08
386 0.09
387 0.09
388 0.09
389 0.15
390 0.17
391 0.17
392 0.17
393 0.24
394 0.33
395 0.38
396 0.39
397 0.35
398 0.36
399 0.4
400 0.43
401 0.4
402 0.35
403 0.32
404 0.3
405 0.31
406 0.28
407 0.25
408 0.23
409 0.19
410 0.15
411 0.13
412 0.14
413 0.12
414 0.12
415 0.12
416 0.11
417 0.1
418 0.12
419 0.14
420 0.16
421 0.19
422 0.18
423 0.2
424 0.21
425 0.22
426 0.23
427 0.22
428 0.29