Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8UCH5

Protein Details
Accession A0A0J8UCH5    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
63-89ITSTPRTPRAKKPKTEKAKSKKQQTLDHydrophilic
NLS Segment(s)
PositionSequence
68-84RTPRAKKPKTEKAKSKK
Subcellular Location(s) mito 15, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MTTLKRSKTLPADGQTTKFLYTILKQLDLKSVDWNLVASQLDISNGHAARMRFSRFRQHMEGITSTPRTPRAKKPKTEKAKSKKQQTLDDLKVWPEPPVIKPEPFIKPEPVNISQIDPCLLAIPRASGPIQAQPFPTVTPVDLVRPYPPSEIPVGYRRPPVGENWPQIKMEPCDQEVVMTDVLVKIEPEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.51
3 0.45
4 0.38
5 0.3
6 0.25
7 0.21
8 0.19
9 0.24
10 0.23
11 0.27
12 0.27
13 0.28
14 0.34
15 0.33
16 0.32
17 0.29
18 0.28
19 0.24
20 0.23
21 0.22
22 0.15
23 0.16
24 0.15
25 0.1
26 0.1
27 0.09
28 0.1
29 0.1
30 0.11
31 0.14
32 0.13
33 0.14
34 0.16
35 0.16
36 0.19
37 0.23
38 0.26
39 0.25
40 0.28
41 0.38
42 0.39
43 0.45
44 0.47
45 0.46
46 0.44
47 0.43
48 0.42
49 0.33
50 0.32
51 0.28
52 0.23
53 0.22
54 0.25
55 0.27
56 0.31
57 0.4
58 0.47
59 0.54
60 0.63
61 0.71
62 0.75
63 0.8
64 0.85
65 0.85
66 0.83
67 0.86
68 0.86
69 0.86
70 0.82
71 0.77
72 0.74
73 0.71
74 0.69
75 0.62
76 0.57
77 0.47
78 0.42
79 0.37
80 0.3
81 0.24
82 0.16
83 0.14
84 0.12
85 0.18
86 0.19
87 0.18
88 0.19
89 0.24
90 0.26
91 0.28
92 0.29
93 0.26
94 0.25
95 0.28
96 0.32
97 0.29
98 0.27
99 0.25
100 0.25
101 0.21
102 0.21
103 0.18
104 0.13
105 0.11
106 0.1
107 0.1
108 0.08
109 0.07
110 0.09
111 0.08
112 0.1
113 0.1
114 0.1
115 0.11
116 0.17
117 0.19
118 0.18
119 0.19
120 0.19
121 0.19
122 0.18
123 0.18
124 0.13
125 0.11
126 0.12
127 0.12
128 0.14
129 0.14
130 0.15
131 0.16
132 0.18
133 0.19
134 0.2
135 0.2
136 0.19
137 0.2
138 0.21
139 0.23
140 0.27
141 0.3
142 0.31
143 0.35
144 0.34
145 0.34
146 0.34
147 0.34
148 0.37
149 0.41
150 0.46
151 0.46
152 0.48
153 0.46
154 0.46
155 0.47
156 0.41
157 0.39
158 0.36
159 0.33
160 0.33
161 0.32
162 0.32
163 0.28
164 0.27
165 0.2
166 0.15
167 0.14
168 0.11
169 0.12
170 0.11