Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8RT87

Protein Details
Accession A0A0J8RT87    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-93ESEKFKVARAERKRPRRARNCKKAVSRLVLSHydrophilic
NLS Segment(s)
PositionSequence
58-84RPIRKESEKFKVARAERKRPRRARNCK
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MALRTTKLTATLARTQGVSGVADLEGFPAFIDLDSALANMDVGLGSMYPTNERGAQSRPIRKESEKFKVARAERKRPRRARNCKKAVSRLVLSMQRQKENWVPGVRDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.27
4 0.24
5 0.18
6 0.11
7 0.1
8 0.09
9 0.08
10 0.08
11 0.07
12 0.06
13 0.05
14 0.05
15 0.04
16 0.05
17 0.04
18 0.05
19 0.04
20 0.05
21 0.05
22 0.05
23 0.04
24 0.04
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.02
32 0.03
33 0.04
34 0.04
35 0.05
36 0.06
37 0.07
38 0.08
39 0.09
40 0.11
41 0.13
42 0.21
43 0.27
44 0.33
45 0.35
46 0.38
47 0.41
48 0.42
49 0.47
50 0.47
51 0.49
52 0.48
53 0.46
54 0.47
55 0.51
56 0.53
57 0.56
58 0.57
59 0.6
60 0.63
61 0.73
62 0.8
63 0.81
64 0.87
65 0.88
66 0.91
67 0.91
68 0.93
69 0.92
70 0.91
71 0.9
72 0.88
73 0.85
74 0.81
75 0.72
76 0.64
77 0.61
78 0.58
79 0.54
80 0.54
81 0.51
82 0.49
83 0.47
84 0.49
85 0.49
86 0.48
87 0.51
88 0.48