Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8QRY2

Protein Details
Accession A0A0J8QRY2    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
62-87ALKNYLRKRCNYKKMNESMYRKKDRCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR023780  Chromo_domain  
Gene Ontology GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF00385  Chromo  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
CDD cd00024  CD_CSD  
Amino Acid Sequences MSKVPTYSSVVLVDNYHEWEVDEILDDKTCYCKRYYLVKWKEFSIEKLMWESEKNLKNTQEALKNYLRKRCNYKKMNESMYRKKDRCDMKQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.16
4 0.14
5 0.13
6 0.13
7 0.12
8 0.1
9 0.1
10 0.09
11 0.09
12 0.1
13 0.09
14 0.09
15 0.15
16 0.17
17 0.17
18 0.17
19 0.2
20 0.23
21 0.32
22 0.4
23 0.44
24 0.52
25 0.57
26 0.57
27 0.55
28 0.56
29 0.47
30 0.41
31 0.36
32 0.28
33 0.22
34 0.22
35 0.21
36 0.17
37 0.17
38 0.17
39 0.19
40 0.23
41 0.25
42 0.27
43 0.28
44 0.29
45 0.33
46 0.35
47 0.35
48 0.31
49 0.34
50 0.38
51 0.44
52 0.48
53 0.52
54 0.52
55 0.51
56 0.6
57 0.65
58 0.69
59 0.7
60 0.74
61 0.76
62 0.81
63 0.84
64 0.83
65 0.82
66 0.82
67 0.84
68 0.85
69 0.77
70 0.72
71 0.71
72 0.71