Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RA64

Protein Details
Accession A0A0J8RA64    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
82-106YESYLLKNTRKSKNNSKYIKDKVQAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16.5, cyto_mito 12.5, mito 7.5
Family & Domain DBs
Amino Acid Sequences MSSASKTIGGVDVNGKTPTKSRAVPVAAAMVTSGDHISGSTPDERKHITLRLGSASDWSKDPRETCACVHVYYKEDKVENGYESYLLKNTRKSKNNSKYIKDKVQAALDNPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.19
4 0.21
5 0.24
6 0.25
7 0.26
8 0.26
9 0.32
10 0.34
11 0.34
12 0.32
13 0.31
14 0.25
15 0.23
16 0.19
17 0.12
18 0.09
19 0.09
20 0.07
21 0.04
22 0.04
23 0.04
24 0.05
25 0.05
26 0.07
27 0.11
28 0.13
29 0.14
30 0.16
31 0.18
32 0.19
33 0.21
34 0.22
35 0.21
36 0.21
37 0.22
38 0.21
39 0.21
40 0.18
41 0.19
42 0.17
43 0.15
44 0.14
45 0.14
46 0.14
47 0.15
48 0.16
49 0.18
50 0.21
51 0.22
52 0.22
53 0.26
54 0.25
55 0.25
56 0.26
57 0.22
58 0.22
59 0.22
60 0.24
61 0.22
62 0.21
63 0.2
64 0.22
65 0.23
66 0.22
67 0.2
68 0.18
69 0.16
70 0.16
71 0.17
72 0.16
73 0.18
74 0.19
75 0.26
76 0.34
77 0.43
78 0.51
79 0.58
80 0.66
81 0.72
82 0.8
83 0.81
84 0.81
85 0.81
86 0.82
87 0.83
88 0.76
89 0.72
90 0.67
91 0.66
92 0.61