Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8QJQ6

Protein Details
Accession A0A0J8QJQ6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
19-46GVEISLHQPPRRRRRKRKNPTRTWVSAFHydrophilic
NLS Segment(s)
PositionSequence
28-38PRRRRRKRKNP
Subcellular Location(s) cysk 13, mito 7, cyto 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038716  P1/P2_N_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Amino Acid Sequences MSNPELAVSYAALILADDGVEISLHQPPRRRRRKRKNPTRTWVSAFSTKRRPFVFFLVHNIPKGMHVLGACGQFCYDFPMGIIRGPIVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.05
10 0.09
11 0.12
12 0.15
13 0.23
14 0.33
15 0.44
16 0.55
17 0.65
18 0.72
19 0.81
20 0.9
21 0.94
22 0.96
23 0.96
24 0.96
25 0.94
26 0.91
27 0.85
28 0.78
29 0.7
30 0.62
31 0.59
32 0.5
33 0.46
34 0.47
35 0.44
36 0.45
37 0.42
38 0.41
39 0.36
40 0.4
41 0.41
42 0.32
43 0.37
44 0.4
45 0.4
46 0.36
47 0.34
48 0.29
49 0.23
50 0.23
51 0.17
52 0.11
53 0.09
54 0.11
55 0.14
56 0.17
57 0.16
58 0.15
59 0.15
60 0.13
61 0.14
62 0.17
63 0.15
64 0.11
65 0.12
66 0.16
67 0.17
68 0.17
69 0.18