Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8QYQ5

Protein Details
Accession A0A0J8QYQ5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
78-103GGTQLRRRNRLPYCRQNTKRQQIACCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAKIDPEFPYSLIVSLPIPTNVLPPSRFVHSKSMKELSMPRPSHTQGSRDPIYHHRSPAAQISPHDTRQMTPQSVAKGGTQLRRRNRLPYCRQNTKRQQIACCVLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.1
5 0.11
6 0.1
7 0.13
8 0.14
9 0.17
10 0.16
11 0.18
12 0.2
13 0.24
14 0.26
15 0.26
16 0.34
17 0.38
18 0.41
19 0.44
20 0.45
21 0.4
22 0.41
23 0.45
24 0.41
25 0.43
26 0.41
27 0.37
28 0.38
29 0.39
30 0.43
31 0.38
32 0.36
33 0.3
34 0.36
35 0.35
36 0.31
37 0.33
38 0.33
39 0.38
40 0.36
41 0.32
42 0.27
43 0.26
44 0.27
45 0.29
46 0.25
47 0.2
48 0.19
49 0.25
50 0.27
51 0.27
52 0.28
53 0.23
54 0.21
55 0.26
56 0.31
57 0.25
58 0.24
59 0.26
60 0.26
61 0.27
62 0.27
63 0.21
64 0.21
65 0.24
66 0.3
67 0.35
68 0.41
69 0.48
70 0.56
71 0.58
72 0.63
73 0.68
74 0.72
75 0.74
76 0.77
77 0.78
78 0.81
79 0.85
80 0.86
81 0.88
82 0.87
83 0.85
84 0.81
85 0.76
86 0.74