Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8TVW0

Protein Details
Accession A0A0J8TVW0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-28KPPIKVPSSREKPMRPRDAPBasic
101-121GQKGYDKRRAEKIRRGCGNNDBasic
NLS Segment(s)
PositionSequence
17-25SREKPMRPR
108-109RR
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MTARDHAAKPPIKVPSSREKPMRPRDAPRGPSEARGECLLVTRSGPSVVGEGSTIIRILCHEIPPPQEEGSGTNPGYIGISNVIFGLVACQPCRKTARGAGQKGYDKRRAEKIRRGCGNNDKSRDVDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.53
4 0.58
5 0.6
6 0.61
7 0.69
8 0.76
9 0.8
10 0.75
11 0.76
12 0.78
13 0.8
14 0.76
15 0.7
16 0.67
17 0.58
18 0.57
19 0.54
20 0.46
21 0.38
22 0.34
23 0.3
24 0.22
25 0.23
26 0.19
27 0.14
28 0.13
29 0.11
30 0.11
31 0.11
32 0.11
33 0.08
34 0.08
35 0.07
36 0.07
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.08
46 0.08
47 0.09
48 0.1
49 0.12
50 0.14
51 0.15
52 0.17
53 0.14
54 0.13
55 0.12
56 0.14
57 0.15
58 0.17
59 0.16
60 0.14
61 0.14
62 0.13
63 0.13
64 0.11
65 0.08
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.05
72 0.05
73 0.06
74 0.07
75 0.08
76 0.09
77 0.12
78 0.13
79 0.18
80 0.22
81 0.22
82 0.24
83 0.31
84 0.41
85 0.48
86 0.53
87 0.54
88 0.58
89 0.64
90 0.66
91 0.66
92 0.63
93 0.58
94 0.58
95 0.64
96 0.67
97 0.68
98 0.71
99 0.74
100 0.76
101 0.81
102 0.8
103 0.78
104 0.78
105 0.8
106 0.79
107 0.75
108 0.68