Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8R3H9

Protein Details
Accession A0A0J8R3H9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
99-124LEEQKEKKEEEKKREKKNNNNDEDDDAcidic
NLS Segment(s)
PositionSequence
105-115KKEEEKKREKK
Subcellular Location(s) cyto 13, cyto_nucl 10, mito 8, nucl 5
Family & Domain DBs
Amino Acid Sequences MAYCKCVTVNTNNMKLILDISAKIRSNYFSLIDAPDHPAPATIIHHLHAAPALPTTTAAAPSPPSSFITTSLPPPSAVRVSACQMAGIRVPVQFTKPVLEEQKEKKEEEKKREKKNNNNDEDDDNDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.32
4 0.24
5 0.18
6 0.13
7 0.15
8 0.21
9 0.21
10 0.22
11 0.22
12 0.21
13 0.21
14 0.23
15 0.21
16 0.16
17 0.17
18 0.18
19 0.18
20 0.17
21 0.2
22 0.19
23 0.18
24 0.16
25 0.15
26 0.13
27 0.13
28 0.14
29 0.11
30 0.11
31 0.12
32 0.13
33 0.12
34 0.12
35 0.11
36 0.1
37 0.07
38 0.07
39 0.06
40 0.05
41 0.05
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.08
49 0.09
50 0.09
51 0.1
52 0.11
53 0.11
54 0.13
55 0.15
56 0.15
57 0.17
58 0.17
59 0.16
60 0.15
61 0.15
62 0.16
63 0.14
64 0.13
65 0.13
66 0.13
67 0.15
68 0.17
69 0.16
70 0.14
71 0.14
72 0.14
73 0.13
74 0.13
75 0.11
76 0.1
77 0.11
78 0.11
79 0.13
80 0.14
81 0.14
82 0.16
83 0.16
84 0.21
85 0.25
86 0.28
87 0.34
88 0.39
89 0.48
90 0.49
91 0.49
92 0.52
93 0.56
94 0.62
95 0.65
96 0.69
97 0.69
98 0.77
99 0.86
100 0.89
101 0.9
102 0.92
103 0.92
104 0.89
105 0.87
106 0.79
107 0.73