Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8QQS7

Protein Details
Accession A0A0J8QQS7    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
129-152GGKGKGKTSRKPTKAAPKKRGKKKBasic
NLS Segment(s)
PositionSequence
63-80TAKIKAPAAKTATKKRGG
117-152SRAKKGAAASKAGGKGKGKTSRKPTKAAPKKRGKKK
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MTDTTPVARNTRAAARRAAAAAEAAANPPQENVQELEDPQQRVEEPKTTTKRGQGKKTTTAATAKIKAPAAKTATKKRGGAKTAATEDTEEADDEGESEQEDSDEEAIDRTPKTTSSRAKKGAAASKAGGKGKGKTSRKPTKAAPKKRGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.37
4 0.36
5 0.32
6 0.23
7 0.18
8 0.16
9 0.13
10 0.11
11 0.1
12 0.1
13 0.1
14 0.1
15 0.1
16 0.1
17 0.09
18 0.11
19 0.11
20 0.13
21 0.14
22 0.14
23 0.21
24 0.25
25 0.25
26 0.24
27 0.23
28 0.21
29 0.23
30 0.25
31 0.23
32 0.22
33 0.31
34 0.36
35 0.4
36 0.43
37 0.47
38 0.54
39 0.57
40 0.62
41 0.62
42 0.62
43 0.65
44 0.66
45 0.6
46 0.53
47 0.47
48 0.42
49 0.38
50 0.36
51 0.29
52 0.28
53 0.28
54 0.27
55 0.25
56 0.25
57 0.24
58 0.27
59 0.32
60 0.37
61 0.42
62 0.44
63 0.47
64 0.48
65 0.5
66 0.47
67 0.44
68 0.38
69 0.36
70 0.35
71 0.33
72 0.28
73 0.22
74 0.2
75 0.18
76 0.15
77 0.1
78 0.08
79 0.07
80 0.06
81 0.06
82 0.06
83 0.05
84 0.04
85 0.04
86 0.04
87 0.04
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.06
95 0.08
96 0.08
97 0.08
98 0.09
99 0.11
100 0.16
101 0.24
102 0.33
103 0.4
104 0.49
105 0.54
106 0.57
107 0.58
108 0.61
109 0.61
110 0.55
111 0.49
112 0.42
113 0.42
114 0.45
115 0.43
116 0.4
117 0.35
118 0.36
119 0.41
120 0.5
121 0.5
122 0.54
123 0.63
124 0.69
125 0.72
126 0.74
127 0.75
128 0.76
129 0.81
130 0.83
131 0.83
132 0.83