Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8R6A0

Protein Details
Accession A0A0J8R6A0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-43LNSKVKSKSKKVGKGGRRWYKDVHydrophilic
NLS Segment(s)
PositionSequence
25-38VKSKSKKVGKGGRR
Subcellular Location(s) nucl 12, mito_nucl 11.999, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR032440  Ribosomal_S11_N  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF16205  Ribosomal_S17_N  
Amino Acid Sequences MATELTVQSERAFQKQPHIFLNSKVKSKSKKVGKGGRRWYKDVGLGFKTPKTAIEGSYIVPIHWSRLHPWPYPDRAPLSPPRCTVPSSSAGNTFTTSPSTTVMRRDTRTLPLTFLPHSVLKKVTRSRWTVQTFEQDCPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.45
4 0.44
5 0.47
6 0.44
7 0.46
8 0.55
9 0.51
10 0.5
11 0.51
12 0.54
13 0.55
14 0.62
15 0.64
16 0.64
17 0.68
18 0.72
19 0.77
20 0.79
21 0.82
22 0.85
23 0.85
24 0.81
25 0.75
26 0.69
27 0.62
28 0.58
29 0.51
30 0.45
31 0.38
32 0.36
33 0.34
34 0.31
35 0.29
36 0.24
37 0.21
38 0.2
39 0.17
40 0.15
41 0.17
42 0.17
43 0.16
44 0.2
45 0.19
46 0.14
47 0.15
48 0.14
49 0.12
50 0.13
51 0.14
52 0.13
53 0.21
54 0.25
55 0.25
56 0.29
57 0.32
58 0.34
59 0.36
60 0.35
61 0.31
62 0.28
63 0.31
64 0.36
65 0.35
66 0.34
67 0.33
68 0.34
69 0.32
70 0.32
71 0.3
72 0.25
73 0.26
74 0.26
75 0.26
76 0.26
77 0.25
78 0.25
79 0.24
80 0.2
81 0.16
82 0.14
83 0.14
84 0.12
85 0.13
86 0.15
87 0.15
88 0.19
89 0.25
90 0.29
91 0.31
92 0.35
93 0.36
94 0.41
95 0.44
96 0.41
97 0.37
98 0.34
99 0.35
100 0.32
101 0.3
102 0.26
103 0.26
104 0.26
105 0.26
106 0.28
107 0.29
108 0.36
109 0.43
110 0.48
111 0.51
112 0.56
113 0.6
114 0.65
115 0.66
116 0.62
117 0.59
118 0.61
119 0.56