FuNGI

A0A0J8R6E2

Protein Details

Accession

A0A0J8R6E2

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
25-55	NPPLGNTSQKRPSKPKKKPLHPRIPFRQLVE	Hydrophilic

NLS Segment(s)

Position	Sequence
34-47	KRPSKPKKKPLHPR

Subcellular Location(s)

mito 9, cyto 9, cyto_mito 9

Family & Domain DBs

InterPro	View protein in InterPro IPR013650 ATP-grasp_succ-CoA_synth-type IPR013815 ATP_grasp_subdomain_1 IPR005811 CoA_ligase IPR017866 Succ-CoA_synthase_bsu_CS IPR005809 Succ_CoA_synthase_bsu IPR016102 Succinyl-CoA_synth-like
Gene Ontology	GO:0005739 C:mitochondrion GO:0005524 F:ATP binding GO:0000287 F:magnesium ion binding GO:0004775 F:succinate-CoA ligase (ADP-forming) activity GO:0006099 P:tricarboxylic acid cycle
Pfam	View protein in Pfam PF08442 ATP-grasp_2 PF00549 Ligase_CoA
PROSITE	View protein in PROSITE PS01217 SUCCINYL_COA_LIG_3

Amino Acid Sequences

MFKLARSRPIAAGPQAYRDRNADINPPLGNTSQKRPSKPKKKPLHPRIPFRQLVEICEVARTADEAEAVAKQLGGEDVVIKAQVLAGGRGKGTFDNGLKGGVRILYSPTEARMFAGQMIGHKLVTKQTGARGRICNAVYICERKYARREFYLAVLMDRASQSPVIVSSSQGGMDIEAVAKENPEAITTTKIDINVGVTDEIARKIAAGLGFSEQCLEEAKDTIQKLYKVFMERDATQIEINPLAETTDYRVLAMDAKLNFDDNAEFRQKEVFSWRDTTQEDPDEVKAAEFGLNFIKLDGDIGCLVNGAGLAMATMDIIKLNGGNPANFLDVGGGATPSAIKSAFELITSDPKVTAIFVNIFGGIVRCDAIAQGLINVVRDMNLRTPIVARLQGTNMEKAHQLINDSGLKIFSIEDLQNAAEKSVQFSKVVKMARDIDVGVEFTLGI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.51
3	0.5
4	0.47
5	0.44
6	0.43
7	0.4
8	0.41
9	0.4
10	0.36
11	0.38
12	0.36
13	0.35
14	0.33
15	0.3
16	0.35
17	0.31
18	0.36
19	0.42
20	0.48
21	0.55
22	0.64
23	0.73
24	0.77
25	0.84
26	0.86
27	0.88
28	0.92
29	0.95
30	0.95
31	0.95
32	0.93
33	0.93
34	0.93
35	0.91
36	0.85
37	0.77
38	0.75
39	0.65
40	0.6
41	0.54
42	0.46
43	0.36
44	0.32
45	0.29
46	0.19
47	0.18
48	0.14
49	0.1
50	0.09
51	0.09
52	0.08
53	0.09
54	0.09
55	0.1
56	0.09
57	0.08
58	0.07
59	0.07
60	0.07
61	0.06
62	0.06
63	0.06
64	0.07
65	0.07
66	0.07
67	0.06
68	0.06
69	0.06
70	0.07
71	0.07
72	0.09
73	0.12
74	0.13
75	0.13
76	0.14
77	0.15
78	0.14
79	0.15
80	0.18
81	0.17
82	0.19
83	0.19
84	0.21
85	0.2
86	0.2
87	0.18
88	0.14
89	0.14
90	0.11
91	0.13
92	0.12
93	0.14
94	0.14
95	0.15
96	0.16
97	0.15
98	0.16
99	0.15
100	0.14
101	0.12
102	0.13
103	0.12
104	0.12
105	0.15
106	0.15
107	0.14
108	0.14
109	0.14
110	0.16
111	0.17
112	0.18
113	0.16
114	0.23
115	0.3
116	0.33
117	0.38
118	0.38
119	0.38
120	0.42
121	0.4
122	0.37
123	0.3
124	0.31
125	0.28
126	0.29
127	0.28
128	0.29
129	0.3
130	0.3
131	0.38
132	0.41
133	0.43
134	0.42
135	0.45
136	0.39
137	0.4
138	0.41
139	0.33
140	0.26
141	0.22
142	0.18
143	0.16
144	0.15
145	0.13
146	0.08
147	0.08
148	0.07
149	0.07
150	0.08
151	0.08
152	0.08
153	0.08
154	0.08
155	0.09
156	0.09
157	0.09
158	0.08
159	0.06
160	0.06
161	0.06
162	0.05
163	0.04
164	0.05
165	0.05
166	0.05
167	0.05
168	0.06
169	0.05
170	0.06
171	0.07
172	0.07
173	0.1
174	0.11
175	0.13
176	0.13
177	0.13
178	0.12
179	0.11
180	0.11
181	0.09
182	0.09
183	0.07
184	0.06
185	0.07
186	0.08
187	0.08
188	0.07
189	0.06
190	0.05
191	0.06
192	0.07
193	0.06
194	0.06
195	0.06
196	0.08
197	0.08
198	0.08
199	0.08
200	0.07
201	0.07
202	0.08
203	0.07
204	0.06
205	0.07
206	0.08
207	0.11
208	0.11
209	0.12
210	0.14
211	0.15
212	0.15
213	0.16
214	0.19
215	0.18
216	0.18
217	0.21
218	0.22
219	0.21
220	0.23
221	0.21
222	0.19
223	0.16
224	0.16
225	0.13
226	0.1
227	0.1
228	0.07
229	0.07
230	0.06
231	0.06
232	0.05
233	0.07
234	0.1
235	0.1
236	0.1
237	0.1
238	0.1
239	0.12
240	0.12
241	0.13
242	0.1
243	0.12
244	0.12
245	0.12
246	0.12
247	0.11
248	0.11
249	0.08
250	0.12
251	0.14
252	0.14
253	0.14
254	0.18
255	0.17
256	0.17
257	0.23
258	0.21
259	0.21
260	0.25
261	0.26
262	0.27
263	0.28
264	0.29
265	0.27
266	0.26
267	0.25
268	0.22
269	0.22
270	0.19
271	0.18
272	0.15
273	0.11
274	0.1
275	0.1
276	0.08
277	0.09
278	0.08
279	0.09
280	0.09
281	0.09
282	0.08
283	0.07
284	0.08
285	0.07
286	0.07
287	0.07
288	0.07
289	0.07
290	0.07
291	0.07
292	0.06
293	0.05
294	0.04
295	0.03
296	0.02
297	0.02
298	0.02
299	0.02
300	0.02
301	0.02
302	0.03
303	0.03
304	0.03
305	0.03
306	0.04
307	0.04
308	0.09
309	0.11
310	0.11
311	0.12
312	0.13
313	0.14
314	0.14
315	0.14
316	0.09
317	0.08
318	0.08
319	0.07
320	0.06
321	0.04
322	0.05
323	0.05
324	0.04
325	0.05
326	0.05
327	0.05
328	0.06
329	0.1
330	0.11
331	0.11
332	0.12
333	0.13
334	0.2
335	0.21
336	0.2
337	0.17
338	0.17
339	0.17
340	0.17
341	0.15
342	0.11
343	0.12
344	0.12
345	0.13
346	0.12
347	0.12
348	0.11
349	0.11
350	0.08
351	0.07
352	0.07
353	0.06
354	0.06
355	0.06
356	0.07
357	0.07
358	0.07
359	0.06
360	0.08
361	0.09
362	0.09
363	0.09
364	0.09
365	0.09
366	0.1
367	0.12
368	0.14
369	0.18
370	0.17
371	0.18
372	0.2
373	0.22
374	0.25
375	0.26
376	0.24
377	0.22
378	0.24
379	0.3
380	0.31
381	0.34
382	0.3
383	0.28
384	0.28
385	0.27
386	0.28
387	0.23
388	0.22
389	0.18
390	0.23
391	0.25
392	0.25
393	0.24
394	0.21
395	0.19
396	0.17
397	0.16
398	0.12
399	0.13
400	0.12
401	0.13
402	0.14
403	0.15
404	0.17
405	0.17
406	0.17
407	0.15
408	0.15
409	0.19
410	0.24
411	0.25
412	0.24
413	0.26
414	0.3
415	0.34
416	0.38
417	0.35
418	0.35
419	0.38
420	0.39
421	0.4
422	0.35
423	0.31
424	0.28
425	0.27
426	0.21

A0A0J8R6E2

3D AlphaFold-predicted Structure Viewer