Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3JAM9

Protein Details
Accession G3JAM9    Localization Confidence High Confidence Score 19.3
NoLS Segment(s)
PositionSequenceProtein Nature
294-313APPAKKTKAAPKTATRAKKSHydrophilic
323-342GAEEEEEKPKPRRRGRPSKABasic
NLS Segment(s)
PositionSequence
115-155KNKPGEKGIRLTAKEKAALEKKDEEDPKPKKRGRASTNKGK
168-203PAKKNKAKKAKAGNDDGNDESPAKKAKAPAKKAKAK
240-250KKTKTAPRGRK
297-314AKKTKAAPKTATRAKKSK
330-342KPKPRRRGRPSKA
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001510  Znf_PARP  
IPR036957  Znf_PARP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0008270  F:zinc ion binding  
KEGG cmt:CCM_03416  -  
Pfam View protein in Pfam  
PF00645  zf-PARP  
Amino Acid Sequences MPQYRIEISPNNRAGCKDTVCKKAAVKITKGEIRFGTWVEIDDRGSWSWKHWGCVSGEQMQRLHDQCRQGNDEWDFDQLDGYDELAANAEVQEKVSRCVKQAHIDAEDFKGDPEKNKPGEKGIRLTAKEKAALEKKDEEDPKPKKRGRASTNKGKDAQADEEDEEEPPAKKNKAKKAKAGNDDGNDESPAKKAKAPAKKAKAKVADEDDDDAPLTKANIGRGRKAKVAKDEEEEEDTSAKKTKTAPRGRKSKQVEEEADDEDEAPPAKKATPKSTPRARQSTQAEEEENEENEAPPAKKTKAAPKTATRAKKSKPVEEDEDEGAEEEEEKPKPRRRGRPSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.45
3 0.45
4 0.44
5 0.46
6 0.51
7 0.52
8 0.55
9 0.53
10 0.54
11 0.58
12 0.56
13 0.52
14 0.51
15 0.57
16 0.59
17 0.57
18 0.53
19 0.46
20 0.42
21 0.39
22 0.34
23 0.29
24 0.23
25 0.23
26 0.21
27 0.21
28 0.18
29 0.17
30 0.19
31 0.17
32 0.19
33 0.18
34 0.19
35 0.27
36 0.28
37 0.3
38 0.3
39 0.33
40 0.33
41 0.39
42 0.4
43 0.39
44 0.4
45 0.4
46 0.39
47 0.36
48 0.38
49 0.35
50 0.34
51 0.3
52 0.35
53 0.35
54 0.4
55 0.44
56 0.4
57 0.45
58 0.43
59 0.42
60 0.36
61 0.34
62 0.28
63 0.23
64 0.21
65 0.14
66 0.13
67 0.1
68 0.1
69 0.08
70 0.08
71 0.08
72 0.08
73 0.07
74 0.06
75 0.06
76 0.07
77 0.06
78 0.07
79 0.11
80 0.11
81 0.14
82 0.19
83 0.2
84 0.21
85 0.27
86 0.3
87 0.34
88 0.38
89 0.4
90 0.37
91 0.37
92 0.37
93 0.32
94 0.29
95 0.22
96 0.17
97 0.17
98 0.15
99 0.17
100 0.21
101 0.27
102 0.3
103 0.34
104 0.35
105 0.38
106 0.45
107 0.45
108 0.44
109 0.42
110 0.44
111 0.43
112 0.44
113 0.41
114 0.36
115 0.35
116 0.32
117 0.33
118 0.33
119 0.33
120 0.34
121 0.33
122 0.33
123 0.38
124 0.4
125 0.37
126 0.4
127 0.47
128 0.52
129 0.57
130 0.58
131 0.58
132 0.63
133 0.7
134 0.69
135 0.72
136 0.71
137 0.73
138 0.77
139 0.75
140 0.69
141 0.6
142 0.53
143 0.45
144 0.39
145 0.3
146 0.24
147 0.19
148 0.18
149 0.18
150 0.15
151 0.13
152 0.11
153 0.09
154 0.1
155 0.13
156 0.14
157 0.17
158 0.25
159 0.35
160 0.45
161 0.49
162 0.55
163 0.63
164 0.69
165 0.72
166 0.71
167 0.65
168 0.56
169 0.54
170 0.47
171 0.37
172 0.29
173 0.23
174 0.17
175 0.14
176 0.14
177 0.12
178 0.13
179 0.18
180 0.26
181 0.35
182 0.43
183 0.52
184 0.59
185 0.67
186 0.69
187 0.71
188 0.71
189 0.63
190 0.6
191 0.56
192 0.48
193 0.41
194 0.4
195 0.32
196 0.25
197 0.23
198 0.18
199 0.12
200 0.1
201 0.08
202 0.07
203 0.09
204 0.13
205 0.2
206 0.21
207 0.28
208 0.33
209 0.36
210 0.4
211 0.45
212 0.45
213 0.47
214 0.52
215 0.49
216 0.48
217 0.48
218 0.44
219 0.42
220 0.38
221 0.3
222 0.24
223 0.21
224 0.18
225 0.19
226 0.17
227 0.15
228 0.22
229 0.29
230 0.39
231 0.49
232 0.59
233 0.64
234 0.75
235 0.77
236 0.8
237 0.79
238 0.79
239 0.76
240 0.74
241 0.68
242 0.61
243 0.59
244 0.51
245 0.44
246 0.34
247 0.27
248 0.19
249 0.16
250 0.13
251 0.1
252 0.09
253 0.09
254 0.12
255 0.16
256 0.21
257 0.29
258 0.38
259 0.45
260 0.55
261 0.64
262 0.71
263 0.75
264 0.79
265 0.73
266 0.72
267 0.71
268 0.7
269 0.65
270 0.59
271 0.52
272 0.44
273 0.45
274 0.38
275 0.32
276 0.25
277 0.2
278 0.16
279 0.16
280 0.2
281 0.17
282 0.17
283 0.22
284 0.22
285 0.27
286 0.33
287 0.42
288 0.47
289 0.55
290 0.6
291 0.64
292 0.72
293 0.77
294 0.81
295 0.78
296 0.78
297 0.75
298 0.77
299 0.75
300 0.74
301 0.72
302 0.7
303 0.7
304 0.66
305 0.64
306 0.57
307 0.51
308 0.42
309 0.34
310 0.27
311 0.19
312 0.15
313 0.12
314 0.15
315 0.17
316 0.22
317 0.3
318 0.39
319 0.49
320 0.59
321 0.68
322 0.74