Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8R3W6

Protein Details
Accession A0A0J8R3W6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
38-57GPCKAGVKWLKKRIGRHCNQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MGCRVCGHSLTMPFISKPKHEGFPHNLSMFARSAQQPGPCKAGVKWLKKRIGRHCNQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.24
4 0.27
5 0.27
6 0.32
7 0.33
8 0.39
9 0.42
10 0.46
11 0.49
12 0.43
13 0.41
14 0.33
15 0.33
16 0.26
17 0.19
18 0.15
19 0.11
20 0.13
21 0.15
22 0.2
23 0.22
24 0.24
25 0.27
26 0.26
27 0.27
28 0.25
29 0.33
30 0.37
31 0.43
32 0.51
33 0.56
34 0.64
35 0.69
36 0.78
37 0.78
38 0.81