Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8R3T6

Protein Details
Accession A0A0J8R3T6    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
243-264SVSVRRAQKKELSRSNREKTRHHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, nucl 9.5, mito_nucl 7, cyto_pero 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
Amino Acid Sequences MNDLERGGSDPRVKYTFVALSYRGYWTSRGRASQKGRIQAPTRLADARLGFHEEYFKDLDGSTTLRRDHGDTVVLWGQSIGAGVATGLAAHQCETKSNRRTSVGGLILETPFLSVQSMLVALYPQRWLPYRYLWPFLRNWWDSEAALKRTGVALQEAGRELERGSERKMRVLIVSAANDELVPGQQSDRLEEICGESGLDVQRQRVAGALHTDATVRAEGRNAVVRFLKELRRGGRKGVVEVSVSVRRAQKKELSRSNREKTRHVVVRDSPAGRSSHVISGLVVEEIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.34
4 0.31
5 0.32
6 0.28
7 0.29
8 0.3
9 0.31
10 0.27
11 0.24
12 0.26
13 0.27
14 0.34
15 0.35
16 0.41
17 0.43
18 0.51
19 0.57
20 0.63
21 0.64
22 0.64
23 0.63
24 0.64
25 0.63
26 0.6
27 0.59
28 0.53
29 0.49
30 0.43
31 0.39
32 0.36
33 0.33
34 0.29
35 0.24
36 0.26
37 0.23
38 0.22
39 0.25
40 0.21
41 0.23
42 0.22
43 0.2
44 0.16
45 0.15
46 0.16
47 0.13
48 0.16
49 0.15
50 0.18
51 0.18
52 0.19
53 0.2
54 0.22
55 0.23
56 0.22
57 0.21
58 0.17
59 0.22
60 0.23
61 0.22
62 0.19
63 0.16
64 0.14
65 0.12
66 0.11
67 0.06
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.02
75 0.03
76 0.03
77 0.04
78 0.06
79 0.06
80 0.1
81 0.15
82 0.25
83 0.32
84 0.36
85 0.39
86 0.4
87 0.41
88 0.4
89 0.42
90 0.36
91 0.29
92 0.26
93 0.23
94 0.2
95 0.19
96 0.16
97 0.09
98 0.06
99 0.06
100 0.05
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.05
110 0.06
111 0.06
112 0.07
113 0.09
114 0.11
115 0.13
116 0.18
117 0.25
118 0.27
119 0.33
120 0.33
121 0.34
122 0.33
123 0.34
124 0.37
125 0.29
126 0.28
127 0.24
128 0.24
129 0.21
130 0.25
131 0.25
132 0.2
133 0.2
134 0.18
135 0.16
136 0.15
137 0.16
138 0.11
139 0.08
140 0.08
141 0.08
142 0.09
143 0.09
144 0.1
145 0.09
146 0.09
147 0.08
148 0.11
149 0.12
150 0.13
151 0.16
152 0.22
153 0.23
154 0.25
155 0.26
156 0.23
157 0.21
158 0.22
159 0.21
160 0.17
161 0.18
162 0.15
163 0.14
164 0.13
165 0.13
166 0.1
167 0.07
168 0.05
169 0.05
170 0.05
171 0.05
172 0.07
173 0.08
174 0.1
175 0.11
176 0.11
177 0.11
178 0.11
179 0.13
180 0.11
181 0.11
182 0.09
183 0.07
184 0.09
185 0.1
186 0.12
187 0.12
188 0.11
189 0.14
190 0.14
191 0.14
192 0.14
193 0.14
194 0.13
195 0.15
196 0.16
197 0.14
198 0.14
199 0.14
200 0.12
201 0.13
202 0.12
203 0.09
204 0.09
205 0.09
206 0.1
207 0.12
208 0.2
209 0.19
210 0.2
211 0.23
212 0.23
213 0.26
214 0.3
215 0.34
216 0.32
217 0.38
218 0.43
219 0.49
220 0.5
221 0.51
222 0.54
223 0.49
224 0.47
225 0.44
226 0.39
227 0.31
228 0.31
229 0.32
230 0.29
231 0.28
232 0.28
233 0.31
234 0.36
235 0.37
236 0.42
237 0.45
238 0.5
239 0.6
240 0.67
241 0.69
242 0.73
243 0.81
244 0.85
245 0.85
246 0.8
247 0.75
248 0.71
249 0.73
250 0.7
251 0.64
252 0.62
253 0.59
254 0.64
255 0.65
256 0.6
257 0.51
258 0.47
259 0.44
260 0.37
261 0.35
262 0.29
263 0.26
264 0.26
265 0.25
266 0.21
267 0.22
268 0.21