Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8R0L7

Protein Details
Accession A0A0J8R0L7   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-29GGLADKFPPRYKKPRLTQKGHGKESCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MASGGLADKFPPRYKKPRLTQKGHGKESCFSSPPPLFVRSTPQERMDCVFRMIRLDNFHQGLTSCEHGGLNHASRNHPKLARSVRGKGPYAWATPSRNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.68
3 0.75
4 0.81
5 0.84
6 0.84
7 0.86
8 0.87
9 0.88
10 0.85
11 0.79
12 0.7
13 0.63
14 0.61
15 0.54
16 0.45
17 0.35
18 0.34
19 0.31
20 0.32
21 0.31
22 0.28
23 0.25
24 0.24
25 0.31
26 0.28
27 0.33
28 0.33
29 0.34
30 0.32
31 0.32
32 0.34
33 0.3
34 0.25
35 0.22
36 0.19
37 0.15
38 0.17
39 0.17
40 0.17
41 0.17
42 0.19
43 0.21
44 0.21
45 0.21
46 0.19
47 0.18
48 0.17
49 0.16
50 0.15
51 0.11
52 0.11
53 0.11
54 0.1
55 0.13
56 0.15
57 0.15
58 0.17
59 0.18
60 0.22
61 0.28
62 0.31
63 0.35
64 0.35
65 0.34
66 0.41
67 0.47
68 0.53
69 0.54
70 0.57
71 0.59
72 0.63
73 0.64
74 0.56
75 0.55
76 0.51
77 0.47
78 0.45
79 0.43