Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8QXK7

Protein Details
Accession A0A0J8QXK7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
49-72CQRPTSGKRRRSARRRCDERPIASHydrophilic
NLS Segment(s)
PositionSequence
55-64GKRRRSARRR
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MYSYKGRRLQGLILLPPYTSIDLQPENGNSGGNGSWPFNGIDAVMKRLCQRPTSGKRRRSARRRCDERPIASKVPRDQHQDSALAWEGLSAAHNKGEILVVGSLSYMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.28
4 0.26
5 0.21
6 0.16
7 0.13
8 0.14
9 0.15
10 0.17
11 0.18
12 0.17
13 0.18
14 0.17
15 0.17
16 0.12
17 0.12
18 0.11
19 0.1
20 0.1
21 0.09
22 0.09
23 0.1
24 0.1
25 0.09
26 0.09
27 0.07
28 0.1
29 0.1
30 0.13
31 0.13
32 0.13
33 0.15
34 0.21
35 0.22
36 0.19
37 0.23
38 0.3
39 0.39
40 0.5
41 0.56
42 0.58
43 0.64
44 0.72
45 0.78
46 0.79
47 0.8
48 0.8
49 0.82
50 0.84
51 0.82
52 0.83
53 0.81
54 0.77
55 0.72
56 0.68
57 0.63
58 0.59
59 0.59
60 0.55
61 0.54
62 0.52
63 0.54
64 0.5
65 0.49
66 0.47
67 0.44
68 0.38
69 0.35
70 0.31
71 0.23
72 0.2
73 0.14
74 0.12
75 0.1
76 0.11
77 0.08
78 0.08
79 0.09
80 0.09
81 0.09
82 0.09
83 0.1
84 0.09
85 0.1
86 0.09
87 0.09
88 0.08