Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8R3Y5

Protein Details
Accession A0A0J8R3Y5   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
142-172KPSWRAAVRKRIKAWWRKIRRRQDDSDDEDFHydrophilic
NLS Segment(s)
PositionSequence
141-163RKPSWRAAVRKRIKAWWRKIRRR
Subcellular Location(s) cyto 13.5, cyto_nucl 9, mito 6, nucl 3.5, pero 3
Family & Domain DBs
Amino Acid Sequences MSENPSIITGYANRAAGPYQMTRVVDFRALSPAYHGSNCVYAHPWAFKEGDGQLMITWYEDKLSTIIAAKLQLNMRGFWKDISLKELPEEVEIDNDGAITIKFVGTTRDAVDRAAKNLRDLIINVYGELLKEEGFKELGLRKPSWRAAVRKRIKAWWRKIRRRQDDSDDEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.2
5 0.17
6 0.17
7 0.2
8 0.21
9 0.22
10 0.23
11 0.23
12 0.23
13 0.21
14 0.19
15 0.21
16 0.21
17 0.19
18 0.2
19 0.22
20 0.21
21 0.21
22 0.21
23 0.16
24 0.2
25 0.2
26 0.19
27 0.18
28 0.16
29 0.18
30 0.2
31 0.19
32 0.17
33 0.18
34 0.16
35 0.17
36 0.16
37 0.17
38 0.14
39 0.14
40 0.11
41 0.11
42 0.11
43 0.08
44 0.08
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.08
54 0.08
55 0.09
56 0.09
57 0.12
58 0.13
59 0.16
60 0.16
61 0.16
62 0.17
63 0.17
64 0.17
65 0.14
66 0.16
67 0.15
68 0.14
69 0.18
70 0.17
71 0.16
72 0.16
73 0.17
74 0.15
75 0.12
76 0.13
77 0.08
78 0.08
79 0.08
80 0.07
81 0.06
82 0.05
83 0.05
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.04
90 0.04
91 0.06
92 0.07
93 0.09
94 0.1
95 0.12
96 0.13
97 0.13
98 0.2
99 0.19
100 0.21
101 0.26
102 0.25
103 0.23
104 0.25
105 0.25
106 0.2
107 0.2
108 0.2
109 0.19
110 0.18
111 0.17
112 0.16
113 0.15
114 0.14
115 0.13
116 0.1
117 0.06
118 0.07
119 0.08
120 0.08
121 0.09
122 0.09
123 0.11
124 0.17
125 0.23
126 0.26
127 0.28
128 0.3
129 0.37
130 0.41
131 0.46
132 0.48
133 0.51
134 0.57
135 0.66
136 0.72
137 0.74
138 0.75
139 0.76
140 0.79
141 0.8
142 0.8
143 0.81
144 0.83
145 0.85
146 0.91
147 0.93
148 0.93
149 0.91
150 0.89
151 0.88
152 0.87