Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8QZE6

Protein Details
Accession A0A0J8QZE6    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-70HQPSKRLKGKARKQARAGKSBasic
NLS Segment(s)
PositionSequence
55-70KRLKGKARKQARAGKS
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR046539  DUF6604  
Pfam View protein in Pfam  
PF20253  DUF6604  
Amino Acid Sequences MVSDFLTSSYLQYKADTNAVASWLATTARKCGYTLGTPTASPEPASTDNLHQPSKRLKGKARKQARAGKSSQGAPRGFTSSNNCLVDEFPTIHPSLDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.19
4 0.17
5 0.16
6 0.17
7 0.16
8 0.13
9 0.11
10 0.09
11 0.1
12 0.1
13 0.1
14 0.12
15 0.14
16 0.15
17 0.15
18 0.16
19 0.18
20 0.2
21 0.22
22 0.23
23 0.22
24 0.21
25 0.23
26 0.23
27 0.2
28 0.16
29 0.13
30 0.13
31 0.14
32 0.16
33 0.15
34 0.16
35 0.2
36 0.23
37 0.24
38 0.2
39 0.22
40 0.26
41 0.34
42 0.37
43 0.38
44 0.44
45 0.53
46 0.62
47 0.7
48 0.73
49 0.72
50 0.76
51 0.8
52 0.78
53 0.74
54 0.67
55 0.63
56 0.56
57 0.55
58 0.5
59 0.48
60 0.42
61 0.37
62 0.37
63 0.35
64 0.32
65 0.3
66 0.33
67 0.3
68 0.37
69 0.36
70 0.34
71 0.31
72 0.31
73 0.29
74 0.25
75 0.24
76 0.18
77 0.2
78 0.2