Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3J4D9

Protein Details
Accession G3J4D9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
179-202FHDSRLRDKKLQSSRKQSRRGGDMHydrophilic
NLS Segment(s)
PositionSequence
187-188KK
193-194RK
Subcellular Location(s) mito 23, cyto 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0016787  F:hydrolase activity  
GO:0003747  F:translation release factor activity  
KEGG cmt:CCM_01314  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MRPIPIVPRVASGALFPASMTLASSTVGSRIGSIRYKRYSAFDADLDKDALAVARRWHAAFDPSQLPSGTTTYARSSGPGGQHVNKLRTETKAISVFPVKDILAVIPPILHPTVRMSPYYTAGSDALTFQAQSHRSRTANADENRKKLASVITQLYDEKVPAETGSDKHAKYKEVVKRFHDSRLRDKKLQSSRKQSRRGGDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.12
4 0.1
5 0.1
6 0.09
7 0.09
8 0.07
9 0.07
10 0.08
11 0.08
12 0.08
13 0.08
14 0.1
15 0.09
16 0.09
17 0.1
18 0.15
19 0.21
20 0.25
21 0.32
22 0.35
23 0.38
24 0.38
25 0.41
26 0.4
27 0.38
28 0.37
29 0.32
30 0.32
31 0.32
32 0.32
33 0.28
34 0.24
35 0.19
36 0.15
37 0.14
38 0.11
39 0.1
40 0.11
41 0.13
42 0.15
43 0.15
44 0.16
45 0.16
46 0.17
47 0.17
48 0.2
49 0.2
50 0.2
51 0.21
52 0.2
53 0.19
54 0.17
55 0.17
56 0.14
57 0.12
58 0.13
59 0.13
60 0.15
61 0.14
62 0.13
63 0.14
64 0.16
65 0.16
66 0.19
67 0.2
68 0.21
69 0.27
70 0.3
71 0.31
72 0.28
73 0.3
74 0.28
75 0.27
76 0.29
77 0.24
78 0.24
79 0.24
80 0.23
81 0.22
82 0.23
83 0.21
84 0.18
85 0.18
86 0.13
87 0.11
88 0.11
89 0.09
90 0.07
91 0.07
92 0.06
93 0.05
94 0.05
95 0.06
96 0.06
97 0.06
98 0.05
99 0.09
100 0.13
101 0.14
102 0.15
103 0.16
104 0.17
105 0.2
106 0.21
107 0.17
108 0.15
109 0.14
110 0.13
111 0.12
112 0.11
113 0.09
114 0.07
115 0.07
116 0.06
117 0.11
118 0.14
119 0.16
120 0.19
121 0.22
122 0.23
123 0.25
124 0.28
125 0.3
126 0.36
127 0.39
128 0.47
129 0.47
130 0.5
131 0.51
132 0.48
133 0.41
134 0.34
135 0.34
136 0.27
137 0.27
138 0.28
139 0.26
140 0.27
141 0.27
142 0.27
143 0.23
144 0.18
145 0.14
146 0.11
147 0.1
148 0.09
149 0.11
150 0.12
151 0.12
152 0.18
153 0.23
154 0.23
155 0.29
156 0.32
157 0.31
158 0.33
159 0.41
160 0.44
161 0.48
162 0.55
163 0.53
164 0.6
165 0.61
166 0.67
167 0.65
168 0.62
169 0.64
170 0.69
171 0.71
172 0.68
173 0.71
174 0.72
175 0.75
176 0.79
177 0.78
178 0.78
179 0.81
180 0.85
181 0.9
182 0.87