Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3JSD9

Protein Details
Accession G3JSD9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-30QSPQIRKRNAHHPVKRPPKLPRMBasic
NLS Segment(s)
PositionSequence
14-28KRNAHHPVKRPPKLP
Subcellular Location(s) nucl 14.5, mito_nucl 13.166, mito 10.5, cyto_nucl 9.333
Family & Domain DBs
KEGG cmt:CCM_08777  -  
Amino Acid Sequences MTIRWQDQSPQIRKRNAHHPVKRPPKLPRMWGIAEKRCDGKAWYYNGKIEASKTSRPASSSWRAKAAEAWNHSENWQLAPKHVHHVLVTGNSYSDNTRQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.72
3 0.72
4 0.74
5 0.73
6 0.75
7 0.78
8 0.84
9 0.85
10 0.82
11 0.8
12 0.79
13 0.76
14 0.73
15 0.68
16 0.64
17 0.61
18 0.61
19 0.6
20 0.57
21 0.54
22 0.49
23 0.45
24 0.38
25 0.36
26 0.29
27 0.27
28 0.26
29 0.28
30 0.31
31 0.31
32 0.32
33 0.32
34 0.32
35 0.26
36 0.22
37 0.22
38 0.21
39 0.21
40 0.23
41 0.23
42 0.23
43 0.24
44 0.25
45 0.26
46 0.32
47 0.36
48 0.35
49 0.39
50 0.39
51 0.38
52 0.42
53 0.41
54 0.39
55 0.35
56 0.39
57 0.35
58 0.35
59 0.35
60 0.33
61 0.27
62 0.23
63 0.27
64 0.21
65 0.23
66 0.27
67 0.29
68 0.32
69 0.33
70 0.31
71 0.25
72 0.27
73 0.27
74 0.26
75 0.26
76 0.19
77 0.18
78 0.17
79 0.18
80 0.19