Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8QY62

Protein Details
Accession A0A0J8QY62    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
106-125ASSYKPRRDQKKALNRWNKFHydrophilic
134-156SAARLCPKTREEKKYRRNTFDLRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.833, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR030700  N-end_Aminoacyl_Trfase  
IPR007471  N-end_Aminoacyl_Trfase_N  
Gene Ontology GO:0004057  F:arginyltransferase activity  
Pfam View protein in Pfam  
PF04376  ATE_N  
Amino Acid Sequences MAALGEVQPGELSFFAPRGKPILSGPESYARDPVIPCTKSCDISGMIVAIAKSADGSASYYASSTSVRVEEYEELLNRGWRRSGTLYYKPNLERSCCPHYTMRLEASSYKPRRDQKKALNRWNKFVLGQEYIRSAARLCPKTREEKKYRRNTFDLRQRVHEAEYSQLKRPVDPKTKRPIEPAHKFEVNIEADSLSLMKFVTYHRYFDSYLRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.14
4 0.15
5 0.17
6 0.18
7 0.19
8 0.2
9 0.28
10 0.28
11 0.29
12 0.31
13 0.37
14 0.38
15 0.38
16 0.37
17 0.29
18 0.28
19 0.26
20 0.3
21 0.31
22 0.29
23 0.28
24 0.34
25 0.36
26 0.35
27 0.35
28 0.31
29 0.23
30 0.23
31 0.24
32 0.16
33 0.13
34 0.12
35 0.12
36 0.09
37 0.07
38 0.06
39 0.05
40 0.04
41 0.04
42 0.04
43 0.05
44 0.06
45 0.07
46 0.07
47 0.07
48 0.07
49 0.08
50 0.08
51 0.07
52 0.08
53 0.08
54 0.08
55 0.09
56 0.11
57 0.11
58 0.12
59 0.14
60 0.13
61 0.14
62 0.14
63 0.18
64 0.16
65 0.16
66 0.15
67 0.13
68 0.16
69 0.18
70 0.24
71 0.27
72 0.34
73 0.38
74 0.38
75 0.43
76 0.41
77 0.44
78 0.4
79 0.36
80 0.32
81 0.34
82 0.39
83 0.35
84 0.37
85 0.33
86 0.35
87 0.35
88 0.34
89 0.29
90 0.23
91 0.23
92 0.23
93 0.25
94 0.31
95 0.3
96 0.3
97 0.34
98 0.41
99 0.49
100 0.54
101 0.58
102 0.59
103 0.68
104 0.75
105 0.79
106 0.82
107 0.76
108 0.73
109 0.68
110 0.59
111 0.48
112 0.42
113 0.35
114 0.28
115 0.27
116 0.23
117 0.2
118 0.2
119 0.2
120 0.16
121 0.13
122 0.14
123 0.22
124 0.26
125 0.26
126 0.32
127 0.35
128 0.46
129 0.54
130 0.6
131 0.61
132 0.67
133 0.76
134 0.81
135 0.86
136 0.83
137 0.81
138 0.78
139 0.78
140 0.77
141 0.76
142 0.69
143 0.65
144 0.63
145 0.57
146 0.51
147 0.44
148 0.35
149 0.32
150 0.38
151 0.36
152 0.36
153 0.38
154 0.37
155 0.37
156 0.41
157 0.44
158 0.46
159 0.5
160 0.55
161 0.61
162 0.69
163 0.69
164 0.72
165 0.72
166 0.72
167 0.75
168 0.71
169 0.68
170 0.62
171 0.59
172 0.53
173 0.51
174 0.42
175 0.33
176 0.28
177 0.2
178 0.18
179 0.18
180 0.17
181 0.09
182 0.07
183 0.06
184 0.05
185 0.06
186 0.08
187 0.18
188 0.2
189 0.23
190 0.26
191 0.31
192 0.32