Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8QJE7

Protein Details
Accession A0A0J8QJE7    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
101-131QRIPSGWTRRRHWRRRRRRHWWASGDRTRLRBasic
NLS Segment(s)
PositionSequence
108-121TRRRHWRRRRRRHW
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, pero 5, cyto 3.5, mito 3
Family & Domain DBs
Amino Acid Sequences MAPDCKCCPDYEDRAARECEDCQRGQGVHAGMCKRIHLLHHQRSFGEVSGRKAQDCQWRGHIVRDDLAWFRELLGGFEDLSIKVSRNPILKGGEPEPASEQRIPSGWTRRRHWRRRRRRHWWASGDRTRLRSSTRECQQHFEYESGPERARQRDIRISANGRRDAQWCRWRDLLALAKTIPGSRLRRQVAHEQKASIWHLPIPRARQGMSICLALETAREVKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.52
4 0.46
5 0.41
6 0.39
7 0.36
8 0.34
9 0.31
10 0.33
11 0.32
12 0.3
13 0.33
14 0.26
15 0.24
16 0.29
17 0.28
18 0.27
19 0.28
20 0.27
21 0.24
22 0.24
23 0.24
24 0.29
25 0.39
26 0.45
27 0.51
28 0.52
29 0.5
30 0.51
31 0.5
32 0.4
33 0.38
34 0.31
35 0.29
36 0.36
37 0.37
38 0.35
39 0.34
40 0.39
41 0.4
42 0.41
43 0.39
44 0.36
45 0.42
46 0.43
47 0.48
48 0.47
49 0.39
50 0.37
51 0.34
52 0.31
53 0.25
54 0.25
55 0.19
56 0.13
57 0.12
58 0.13
59 0.12
60 0.11
61 0.1
62 0.1
63 0.09
64 0.1
65 0.1
66 0.07
67 0.09
68 0.09
69 0.08
70 0.1
71 0.12
72 0.15
73 0.17
74 0.18
75 0.2
76 0.22
77 0.23
78 0.25
79 0.24
80 0.26
81 0.23
82 0.23
83 0.23
84 0.22
85 0.23
86 0.2
87 0.19
88 0.15
89 0.15
90 0.16
91 0.17
92 0.25
93 0.29
94 0.35
95 0.39
96 0.5
97 0.6
98 0.69
99 0.76
100 0.77
101 0.82
102 0.87
103 0.94
104 0.93
105 0.94
106 0.94
107 0.93
108 0.92
109 0.89
110 0.88
111 0.84
112 0.8
113 0.72
114 0.65
115 0.56
116 0.47
117 0.41
118 0.37
119 0.36
120 0.39
121 0.43
122 0.48
123 0.48
124 0.52
125 0.51
126 0.5
127 0.46
128 0.38
129 0.31
130 0.26
131 0.27
132 0.25
133 0.23
134 0.22
135 0.24
136 0.26
137 0.31
138 0.32
139 0.35
140 0.4
141 0.43
142 0.44
143 0.46
144 0.49
145 0.49
146 0.53
147 0.51
148 0.45
149 0.44
150 0.43
151 0.42
152 0.45
153 0.47
154 0.43
155 0.44
156 0.44
157 0.42
158 0.4
159 0.42
160 0.41
161 0.35
162 0.34
163 0.29
164 0.29
165 0.29
166 0.28
167 0.23
168 0.22
169 0.26
170 0.3
171 0.39
172 0.42
173 0.45
174 0.5
175 0.59
176 0.62
177 0.64
178 0.61
179 0.54
180 0.51
181 0.53
182 0.52
183 0.43
184 0.34
185 0.29
186 0.29
187 0.34
188 0.38
189 0.38
190 0.41
191 0.41
192 0.41
193 0.42
194 0.41
195 0.41
196 0.37
197 0.33
198 0.27
199 0.24
200 0.23
201 0.17
202 0.16
203 0.14