Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3J9J1

Protein Details
Accession G3J9J1    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-40VATLTRRKLPRRSTLQAKNEATHydrophilic
49-72EIKVVEKPKKARAARKPPVRDVSAHydrophilic
395-415AVTPRERRKHAPRVKVLPPCAHydrophilic
NLS Segment(s)
PositionSequence
55-65KPKKARAARKP
Subcellular Location(s) cyto 14.5, cyto_mito 10.5, nucl 6, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004601  UvdE  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0006289  P:nucleotide-excision repair  
GO:0009411  P:response to UV  
KEGG cmt:CCM_03240  -  
Pfam View protein in Pfam  
PF03851  UvdE  
Amino Acid Sequences MAPKRKAAVVETVVAAAEVATLTRRKLPRRSTLQAKNEATETLTEITSEIKVVEKPKKARAARKPPVRDVSAEDEAGNDEEASSAERGARRPPPVNSDELPLPWSGRLGYACLNTYLRTANPPVFSSRTCRIASILEHRHPLLDPSQPEHPTKNRPDKSQPASVARGLLFVQSLGLANARDIIPMLRWNEKYGIKFMRLSSEMFPFASHAEYGYKLAPFAADALAAAGRVAATLGHRLTTHPGQFTQIGSPRAEVVAASLRDLAYHDELLSLLRLPPQQDRDAVMIIHMGGTFGDKQATLARFRANYARLPRGVRDRLVLENDDVAWSVHDLLPVCEELDIPLVLDYHHHNIVFDAARLREGTLDIAALYPRIAATWARKGITQKMHYSEPTAGAVTPRERRKHAPRVKVLPPCARDMDLMIEAKDKEQAVLELMRTYRLPGWDRARDIVPYERDDDEPRPAQKAAAKRAKGETNGGEAVVAAEDFGMGGPENRVYWPLGMEEWLRPRKKGSEKEAKEVVESDIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.11
4 0.08
5 0.05
6 0.04
7 0.07
8 0.09
9 0.11
10 0.19
11 0.27
12 0.34
13 0.44
14 0.53
15 0.6
16 0.69
17 0.76
18 0.79
19 0.83
20 0.84
21 0.84
22 0.79
23 0.7
24 0.62
25 0.54
26 0.44
27 0.35
28 0.28
29 0.2
30 0.17
31 0.14
32 0.13
33 0.14
34 0.13
35 0.12
36 0.1
37 0.1
38 0.14
39 0.21
40 0.29
41 0.36
42 0.42
43 0.5
44 0.6
45 0.66
46 0.73
47 0.76
48 0.79
49 0.81
50 0.86
51 0.86
52 0.85
53 0.85
54 0.77
55 0.68
56 0.63
57 0.6
58 0.53
59 0.45
60 0.36
61 0.29
62 0.27
63 0.25
64 0.2
65 0.11
66 0.08
67 0.07
68 0.08
69 0.09
70 0.08
71 0.08
72 0.11
73 0.14
74 0.15
75 0.22
76 0.28
77 0.33
78 0.38
79 0.42
80 0.47
81 0.47
82 0.52
83 0.46
84 0.44
85 0.4
86 0.35
87 0.32
88 0.25
89 0.23
90 0.17
91 0.16
92 0.12
93 0.12
94 0.12
95 0.13
96 0.15
97 0.17
98 0.17
99 0.19
100 0.2
101 0.18
102 0.19
103 0.19
104 0.16
105 0.18
106 0.2
107 0.22
108 0.23
109 0.24
110 0.27
111 0.28
112 0.29
113 0.31
114 0.32
115 0.34
116 0.33
117 0.32
118 0.29
119 0.29
120 0.32
121 0.35
122 0.39
123 0.36
124 0.38
125 0.37
126 0.37
127 0.34
128 0.32
129 0.25
130 0.23
131 0.21
132 0.22
133 0.29
134 0.31
135 0.33
136 0.36
137 0.39
138 0.42
139 0.5
140 0.58
141 0.56
142 0.6
143 0.67
144 0.71
145 0.71
146 0.69
147 0.65
148 0.59
149 0.57
150 0.52
151 0.46
152 0.36
153 0.31
154 0.23
155 0.18
156 0.13
157 0.09
158 0.08
159 0.06
160 0.06
161 0.05
162 0.06
163 0.05
164 0.05
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.07
171 0.11
172 0.14
173 0.18
174 0.19
175 0.21
176 0.26
177 0.29
178 0.29
179 0.31
180 0.32
181 0.28
182 0.31
183 0.29
184 0.3
185 0.27
186 0.28
187 0.24
188 0.23
189 0.22
190 0.19
191 0.19
192 0.14
193 0.13
194 0.12
195 0.1
196 0.08
197 0.08
198 0.08
199 0.1
200 0.1
201 0.1
202 0.09
203 0.09
204 0.08
205 0.07
206 0.07
207 0.06
208 0.04
209 0.04
210 0.05
211 0.05
212 0.04
213 0.04
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.06
221 0.06
222 0.07
223 0.07
224 0.08
225 0.12
226 0.16
227 0.17
228 0.16
229 0.17
230 0.18
231 0.19
232 0.19
233 0.18
234 0.19
235 0.19
236 0.18
237 0.18
238 0.16
239 0.15
240 0.14
241 0.1
242 0.07
243 0.1
244 0.1
245 0.1
246 0.1
247 0.1
248 0.1
249 0.11
250 0.11
251 0.07
252 0.08
253 0.07
254 0.07
255 0.07
256 0.07
257 0.07
258 0.05
259 0.05
260 0.07
261 0.08
262 0.1
263 0.13
264 0.16
265 0.18
266 0.19
267 0.2
268 0.2
269 0.19
270 0.17
271 0.14
272 0.11
273 0.09
274 0.08
275 0.06
276 0.04
277 0.03
278 0.05
279 0.05
280 0.05
281 0.05
282 0.05
283 0.06
284 0.1
285 0.12
286 0.13
287 0.15
288 0.17
289 0.17
290 0.19
291 0.23
292 0.2
293 0.24
294 0.28
295 0.31
296 0.32
297 0.33
298 0.35
299 0.39
300 0.39
301 0.35
302 0.32
303 0.3
304 0.3
305 0.31
306 0.28
307 0.2
308 0.18
309 0.17
310 0.15
311 0.12
312 0.09
313 0.07
314 0.06
315 0.07
316 0.07
317 0.08
318 0.08
319 0.08
320 0.09
321 0.09
322 0.09
323 0.08
324 0.07
325 0.06
326 0.07
327 0.07
328 0.06
329 0.06
330 0.06
331 0.06
332 0.07
333 0.09
334 0.11
335 0.13
336 0.13
337 0.12
338 0.13
339 0.16
340 0.16
341 0.14
342 0.14
343 0.12
344 0.13
345 0.14
346 0.14
347 0.11
348 0.1
349 0.1
350 0.08
351 0.08
352 0.07
353 0.07
354 0.07
355 0.06
356 0.06
357 0.05
358 0.05
359 0.05
360 0.06
361 0.07
362 0.12
363 0.2
364 0.23
365 0.23
366 0.26
367 0.29
368 0.36
369 0.43
370 0.43
371 0.41
372 0.42
373 0.45
374 0.44
375 0.44
376 0.38
377 0.31
378 0.27
379 0.22
380 0.18
381 0.16
382 0.19
383 0.21
384 0.27
385 0.32
386 0.36
387 0.39
388 0.48
389 0.57
390 0.65
391 0.69
392 0.71
393 0.73
394 0.77
395 0.81
396 0.8
397 0.78
398 0.75
399 0.69
400 0.63
401 0.56
402 0.49
403 0.41
404 0.34
405 0.3
406 0.25
407 0.23
408 0.19
409 0.2
410 0.19
411 0.19
412 0.2
413 0.17
414 0.14
415 0.14
416 0.14
417 0.13
418 0.15
419 0.16
420 0.16
421 0.16
422 0.17
423 0.16
424 0.18
425 0.18
426 0.22
427 0.25
428 0.3
429 0.38
430 0.43
431 0.46
432 0.47
433 0.46
434 0.42
435 0.42
436 0.42
437 0.37
438 0.34
439 0.34
440 0.33
441 0.34
442 0.36
443 0.36
444 0.35
445 0.37
446 0.36
447 0.36
448 0.35
449 0.36
450 0.37
451 0.43
452 0.46
453 0.49
454 0.5
455 0.51
456 0.58
457 0.6
458 0.58
459 0.56
460 0.48
461 0.44
462 0.42
463 0.37
464 0.3
465 0.24
466 0.21
467 0.15
468 0.11
469 0.05
470 0.04
471 0.04
472 0.04
473 0.04
474 0.04
475 0.04
476 0.05
477 0.07
478 0.08
479 0.1
480 0.1
481 0.12
482 0.13
483 0.14
484 0.14
485 0.15
486 0.14
487 0.16
488 0.18
489 0.22
490 0.3
491 0.39
492 0.4
493 0.4
494 0.44
495 0.51
496 0.59
497 0.63
498 0.64
499 0.66
500 0.7
501 0.77
502 0.79
503 0.7
504 0.62
505 0.54
506 0.46