Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8QWW7

Protein Details
Accession A0A0J8QWW7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-107SVTPLQVRRKRGPSRRRQSSRQRYEKQQSRNLRRWHydrophilic
NLS Segment(s)
PositionSequence
80-98RRKRGPSRRRQSSRQRYEK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAPITTRGDSKSNKQDNEEAEQARKREGKEMTSVRGQGRYARYQIHRRRRGTAGINVEERCGVAARSQLRVSSVTPLQVRRKRGPSRRRQSSRQRYEKQQSRNLRRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.54
4 0.57
5 0.54
6 0.46
7 0.44
8 0.45
9 0.41
10 0.42
11 0.41
12 0.35
13 0.36
14 0.36
15 0.33
16 0.38
17 0.41
18 0.39
19 0.4
20 0.42
21 0.36
22 0.36
23 0.33
24 0.3
25 0.31
26 0.31
27 0.29
28 0.31
29 0.36
30 0.44
31 0.53
32 0.58
33 0.63
34 0.61
35 0.64
36 0.61
37 0.61
38 0.56
39 0.53
40 0.48
41 0.42
42 0.42
43 0.37
44 0.34
45 0.28
46 0.23
47 0.16
48 0.11
49 0.08
50 0.06
51 0.1
52 0.12
53 0.15
54 0.15
55 0.15
56 0.16
57 0.18
58 0.17
59 0.18
60 0.17
61 0.19
62 0.21
63 0.27
64 0.36
65 0.4
66 0.46
67 0.49
68 0.58
69 0.64
70 0.72
71 0.77
72 0.78
73 0.84
74 0.88
75 0.89
76 0.89
77 0.9
78 0.91
79 0.91
80 0.91
81 0.88
82 0.87
83 0.9
84 0.89
85 0.87
86 0.86
87 0.86