Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8R3P6

Protein Details
Accession A0A0J8R3P6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
73-102ANGMKKRGPGRPKKGEAKKQQKTPTPRSTDBasic
NLS Segment(s)
PositionSequence
75-100GMKKRGPGRPKKGEAKKQQKTPTPRS
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MYTSSSLSGVYISPRASRPAIGEKREHDESGTAKEGKATSEGPPEKKQKVETEKQPDGEAKPASPNRENVDAANGMKKRGPGRPKKGEAKKQQKTPTPRSTDGIGSRTRSRTKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.22
4 0.23
5 0.25
6 0.33
7 0.39
8 0.4
9 0.44
10 0.43
11 0.49
12 0.5
13 0.46
14 0.36
15 0.32
16 0.29
17 0.29
18 0.3
19 0.24
20 0.21
21 0.23
22 0.22
23 0.2
24 0.2
25 0.17
26 0.14
27 0.23
28 0.27
29 0.29
30 0.35
31 0.4
32 0.4
33 0.42
34 0.43
35 0.42
36 0.47
37 0.5
38 0.52
39 0.55
40 0.56
41 0.54
42 0.52
43 0.45
44 0.38
45 0.35
46 0.26
47 0.17
48 0.21
49 0.23
50 0.26
51 0.26
52 0.28
53 0.27
54 0.31
55 0.31
56 0.24
57 0.25
58 0.22
59 0.21
60 0.25
61 0.22
62 0.19
63 0.19
64 0.23
65 0.23
66 0.29
67 0.39
68 0.43
69 0.53
70 0.62
71 0.69
72 0.77
73 0.83
74 0.86
75 0.87
76 0.88
77 0.86
78 0.86
79 0.86
80 0.85
81 0.84
82 0.84
83 0.83
84 0.8
85 0.75
86 0.69
87 0.63
88 0.61
89 0.57
90 0.52
91 0.46
92 0.43
93 0.46
94 0.5