Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8QLA5

Protein Details
Accession A0A0J8QLA5   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-46ECSQEHSWPRKKKLPKPKLHITHDALHydrophilic
NLS Segment(s)
PositionSequence
30-38RKKKLPKPK
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MRNHAVEENSQNRSQGIVYIECSQEHSWPRKKKLPKPKLHITHDALAARPNCSACGVEALGRDKRRALLEAGYTREMDIMGLLASNAEASVKRAVFPSSIMSDLGLSSLSRTAGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.22
3 0.2
4 0.16
5 0.18
6 0.21
7 0.21
8 0.2
9 0.24
10 0.21
11 0.23
12 0.28
13 0.34
14 0.4
15 0.48
16 0.56
17 0.61
18 0.7
19 0.75
20 0.8
21 0.82
22 0.83
23 0.83
24 0.86
25 0.86
26 0.83
27 0.81
28 0.74
29 0.67
30 0.6
31 0.52
32 0.42
33 0.37
34 0.31
35 0.23
36 0.2
37 0.16
38 0.12
39 0.13
40 0.12
41 0.08
42 0.09
43 0.09
44 0.09
45 0.1
46 0.13
47 0.17
48 0.18
49 0.18
50 0.16
51 0.18
52 0.18
53 0.19
54 0.17
55 0.16
56 0.21
57 0.24
58 0.26
59 0.25
60 0.23
61 0.22
62 0.2
63 0.17
64 0.11
65 0.08
66 0.05
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.06
77 0.11
78 0.11
79 0.12
80 0.13
81 0.15
82 0.15
83 0.16
84 0.18
85 0.16
86 0.17
87 0.17
88 0.16
89 0.15
90 0.14
91 0.13
92 0.1
93 0.07
94 0.07
95 0.09
96 0.1